Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04940
Gene name
Locationscaffold_05:2019023..2020381
Strand+
Gene length (bp)1358
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 2.9E-13 189 344

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7407 0.3123 0.02 0.2379 0.2834 0.0121 0.0503 0.5199 0.3264 0.0337

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2829
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|880
Ophiocordyceps australis map64 (Brazil) OphauB2|297
Ophiocordyceps camponoti-floridani Ophcf2|04940 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3818
Ophiocordyceps kimflemingae Ophio5|4624
Ophiocordyceps subramaniannii Hirsu2|4589

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04940
MASAPASVRVSGPPNSSFLVGYPGISATLPRIEGKVEIRPGQGYSMPVAVSLVRICLQRRETIHPDAESLTKRHL
GTPRRETADVVGKEVLLFRCSTGKEAESVMAMDLPFILFIPFGRGGEETNRRIPPASLQLPSRTLETYYELVVTV
QQGHSNQYKYSFPMPLQRYDTLSTFGMYNKPETKLVTTDNVVHLGINLPRWSFGPNDPVTVYLKLSPNPDWMTKA
RRVTIEKITLAIEEEITFNPEGDEPTKKINKLSKQAQVVKMKMPEAGYATNIGLVFPCKDLRDSDGIVKRGRPAF
PLYEVHSFTTTSSLYKIEFYVTIKVQLSGARDVSLRQPVVICPLDQQGCKEEMDAIEQAAKDAALIDPNNPMLPA
RTIVLASDRDALRSLGLCTVGGQKKPFIE*
Coding >Ophcf2|04940
ATGGCCTCCGCCCCGGCCAGCGTGAGGGTCTCGGGGCCCCCAAATAGCAGCTTTTTGGTCGGATATCCGGGTATC
TCGGCGACACTGCCTCGCATCGAGGGCAAGGTCGAGATTCGCCCCGGCCAGGGCTATTCCATGCCTGTCGCCGTC
TCTCTCGTCCGCATATGTCTGCAGCGGCGCGAGACGATCCATCCCGATGCCGAGAGCCTCACTAAGCGTCACCTC
GGCACCCCTCGACGCGAGACGGCCGACGTGGTCGGCAAAGAGGTGCTGCTCTTCCGGTGCTCCACCGGAAAGGAG
GCTGAGAGCGTCATGGCCATGGACCTGCCCTTTATTCTGTTCATCCCCTTCGGCCGAGGCGGCGAGGAGACGAAC
CGGAGGATCCCCCCGGCCTCGCTGCAGCTACCCAGCAGGACGCTAGAGACCTACTACGAGCTCGTCGTCACCGTA
CAGCAGGGCCACAGCAATCAGTACAAATACAGCTTCCCCATGCCGCTCCAGCGCTACGATACCCTCTCGACTTTT
GGCATGTACAACAAGCCCGAGACCAAGCTCGTCACGACCGACAACGTCGTCCATCTCGGCATCAACCTGCCGCGC
TGGAGCTTCGGCCCCAACGACCCCGTTACCGTCTACCTCAAGCTGTCGCCGAACCCGGACTGGATGACAAAAGCC
CGCCGCGTCACCATTGAAAAGATTACACTGGCCATTGAGGAGGAAATCACCTTTAACCCCGAGGGTGACGAGCCG
ACCAAGAAGATCAATAAGCTGTCCAAGCAGGCGCAGGTGGTCAAGATGAAGATGCCCGAGGCCGGATACGCCACC
AACATAGGCCTAGTTTTCCCTTGCAAGGACCTGAGAGACTCGGACGGCATCGTCAAGCGGGGGAGGCCGGCATTC
CCTCTCTACGAGGTACATTCCTTCACCACTACCTCGAGCCTGTACAAGATTGAGTTTTACGTCACCATCAAGGTG
CAACTCAGCGGCGCCCGCGACGTCAGCCTGAGGCAGCCTGTCGTCATCTGTCCGCTGGACCAACAGGGGTGCAAG
GAAGAGATGGACGCCATCGAACAGGCGGCCAAGGACGCTGCCCTCATCGACCCCAACAACCCCATGCTACCGGCC
CGCACCATTGTCCTGGCCAGCGACCGCGACGCGCTGCGGAGTCTCGGGCTGTGCACCGTCGGCGGACAGAAGAAG
CCCTTTATCGAATGA
Transcript >Ophcf2|04940
ATGGCCTCCGCCCCGGCCAGCGTGAGGGTCTCGGGGCCCCCAAATAGCAGCTTTTTGGTCGGATATCCGGGTATC
TCGGCGACACTGCCTCGCATCGAGGGCAAGGTCGAGATTCGCCCCGGCCAGGGCTATTCCATGCCTGTCGCCGTC
TCTCTCGTCCGCATATGTCTGCAGCGGCGCGAGACGATCCATCCCGATGCCGAGAGCCTCACTAAGCGTCACCTC
GGCACCCCTCGACGCGAGACGGCCGACGTGGTCGGCAAAGAGGTGCTGCTCTTCCGGTGCTCCACCGGAAAGGAG
GCTGAGAGCGTCATGGCCATGGACCTGCCCTTTATTCTGTTCATCCCCTTCGGCCGAGGCGGCGAGGAGACGAAC
CGGAGGATCCCCCCGGCCTCGCTGCAGCTACCCAGCAGGACGCTAGAGACCTACTACGAGCTCGTCGTCACCGTA
CAGCAGGGCCACAGCAATCAGTACAAATACAGCTTCCCCATGCCGCTCCAGCGCTACGATACCCTCTCGACTTTT
GGCATGTACAACAAGCCCGAGACCAAGCTCGTCACGACCGACAACGTCGTCCATCTCGGCATCAACCTGCCGCGC
TGGAGCTTCGGCCCCAACGACCCCGTTACCGTCTACCTCAAGCTGTCGCCGAACCCGGACTGGATGACAAAAGCC
CGCCGCGTCACCATTGAAAAGATTACACTGGCCATTGAGGAGGAAATCACCTTTAACCCCGAGGGTGACGAGCCG
ACCAAGAAGATCAATAAGCTGTCCAAGCAGGCGCAGGTGGTCAAGATGAAGATGCCCGAGGCCGGATACGCCACC
AACATAGGCCTAGTTTTCCCTTGCAAGGACCTGAGAGACTCGGACGGCATCGTCAAGCGGGGGAGGCCGGCATTC
CCTCTCTACGAGGTACATTCCTTCACCACTACCTCGAGCCTGTACAAGATTGAGTTTTACGTCACCATCAAGGTG
CAACTCAGCGGCGCCCGCGACGTCAGCCTGAGGCAGCCTGTCGTCATCTGTCCGCTGGACCAACAGGGGTGCAAG
GAAGAGATGGACGCCATCGAACAGGCGGCCAAGGACGCTGCCCTCATCGACCCCAACAACCCCATGCTACCGGCC
CGCACCATTGTCCTGGCCAGCGACCGCGACGCGCTGCGGAGTCTCGGGCTGTGCACCGTCGGCGGACAGAAGAAG
CCCTTTATCGAATGA
Gene >Ophcf2|04940
ATGGCCTCCGCCCCGGCCAGCGTGAGGGTCTCGGGGCCCCCAAATAGCAGCTTTTTGGTCGGATATCCGGGTATC
TCGGCGACACTGGTACGTTCCTGTCCCCCCTCTTCTGTCTTTTCAGTTGCCGCCTTCATTTTGCTTCTCTTTCTC
CTTTGCTGACGCGACTGCCAGCCTCGCATCGAGGGCAAGGTCGAGATTCGCCCCGGCCAGGGCTATTCCATGCCT
GTCGCCGTCTCTCTCGTCCGCATATGTCTGCAGCGGCGCGAGACGATCCATCCCGATGCCGAGAGCCTCACTAAG
CGTCACCTCGGCACCCCTCGACGCGAGACGGCCGACGTGGTCGGCAAAGAGGTGCTGCTCTTCCGGTGCTCCACC
GGAAAGGAGGCTGAGAGCGTCATGGCCATGGACCTGCCCTTTATTCTGTTCATCCCCTTCGGCCGAGGCGGCGAG
GAGACGAACCGGAGGATCCCCCCGGCCTCGCTGCAGCTACCCAGCAGGACGCTAGAGACCTACTACGAGCTCGTC
GTCACCGTACAGCAGGGCCACAGCAATCAGTACAAATACAGCTTCCCCATGCCGCTCCAGCGCTACGATACCCTC
TCGACTTTTGGCATGTACAACAAGCCCGAGACCAAGCTCGTCACGACCGACAACGTCGTCCATCTCGGCATCAAC
CTGCCGCGCTGGAGCTTCGGCCCCAACGACCCCGTTACCGTCTACCTCAAGCTGTCGCCGAACCCGGACTGGATG
ACAAAAGCCCGCCGCGTCACCATTGAAAAGATTACACTGGCCATTGAGGAGGAAATCACCTTTAACCCCGAGGGT
GACGAGCCGACCAAGAAGATCAATAAGCTGTCCAAGCAGGCGCAGGTGGTCAAGATGAAGATGCCCGAGGCCGGA
TACGCCACCAACATAGGCCTAGTTTTCCCTTGCAAGGACCTGAGAGACTCGGACGGCATCGTCAAGCGGGGGAGG
CCGGCATTCCCTCTCTACGAGGTACATTCCTTCACCACTACCTCGAGCCTGTACAAGATTGAGTTTTACGTCACC
ATCAAGGTAAAGGGACACCCTCCCCGTCCGCTTTGCTCCGTCGTTGTAGCTGACGCCCTCGCCAGGTGCAACTCA
GCGGCGCCCGCGACGTCAGCCTGAGGCAGCCTGTCGTCATCTGTCCGCTGGACCAACAGGGGTGCAAGGAAGAGA
TGGACGCCATCGAACAGGCGGCCAAGGACGCTGCCCTCATCGACCCCAACAACCCCATGCTACCGGCCCGCACCA
TTGTCCTGGCCAGCGACCGCGACGCGCTGCGGAGTCTCGGGCTGTGCACCGTCGGCGGACAGAAGAAGCCCTTTA
TCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail