Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04928
Gene name
Locationscaffold_05:1987964..1990171
Strand-
Gene length (bp)2207
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08953 DUF1899 Domain of unknown function (DUF1899) 1.5E-33 4 69
PF16300 WD40_4 Type of WD40 repeat 9.8E-19 347 388
PF00400 WD40 WD domain, G-beta repeat 4.3E-03 77 109
PF00400 WD40 WD domain, G-beta repeat 5.6E-03 129 166
PF00400 WD40 WD domain, G-beta repeat 6.5E-04 178 207
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.1E-04 177 231

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7136 0.4423 0.0686 0.0869 0.0324 0.0062 0.0617 0.2903 0.1793 0.0047

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2262
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4790
Ophiocordyceps australis map64 (Brazil) OphauB2|7538
Ophiocordyceps camponoti-floridani Ophcf2|04928 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6549
Ophiocordyceps kimflemingae Ophio5|8306
Ophiocordyceps subramaniannii Hirsu2|2953

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04928
MAGRFVRASKYRHVYGKSTRKEFCYDNLHISRNAWDTNLVKVNPSYLSVNWDASGGGAFAVIPLSERGKLPDQIP
LFRGHTAAVLDTDWNPFNDHLVASASEDGKVFLWEVPQDFTLHIDAEEIPDVSPVSKLGGHSRKVGQVLFNPSAE
NILASASGDFSIKIWDIGTGQAPITLKHGDIVQGLSWNAAGNMLVTTSRDKKIRVWDVRQDKAVHEAPGHSGAKN
SRVVWMGEHNRFATTGFSRMSERQIGLWEPGRVDPIGGFNMLDSISGVCIPFWDDGSNCLYLAGKGDGNIRYFEY
ENDKFEFLSEYKSPDPQRGIAFLPRRGINVHENEVMRAYKTVSDTYIEPISFTVPRRAETFQADIFPPAIGTKPA
ATAKEWLDGKTGIPSKIDLESIYEGGAPKEVSSDYKPPPAQPTPRAEPKKDESARREEPKPTPSRGPPPSMKEQK
GSMAAAASKFQDDDDGPATMDDETSSFEEVSRPTQRSAAAVRSEPTPSKPAPAKAASFPTKTPSSPPAPSSSGGV
ESSLSEMRRLIEKQSQMMDAQKDKMDALVAEVESLKKKVNAAGQDQSERIRQLELELESRS*
Coding >Ophcf2|04928
ATGGCTGGCCGTTTCGTGCGGGCGTCCAAGTATCGGCACGTCTATGGAAAGTCGACGCGCAAGGAGTTTTGCTAC
GATAATCTGCACATCAGCCGCAATGCCTGGGATACGAATCTCGTCAAGGTCAACCCTTCGTACCTCTCCGTCAAC
TGGGATGCTTCGGGAGGCGGTGCCTTTGCCGTCATTCCGCTTTCCGAGAGGGGCAAGCTGCCTGATCAGATTCCG
CTCTTTCGGGGACATACGGCTGCTGTGCTCGATACCGACTGGAATCCGTTCAACGATCATCTCGTTGCCTCTGCT
TCCGAGGATGGCAAGGTCTTTCTCTGGGAGGTGCCGCAAGACTTTACTCTCCACATAGACGCCGAAGAGATTCCC
GACGTGTCCCCCGTCAGCAAGCTTGGCGGTCATTCTCGAAAAGTCGGACAGGTCTTGTTCAACCCCTCGGCCGAA
AATATCCTCGCCTCCGCCTCGGGTGACTTCTCCATCAAGATATGGGACATTGGCACCGGCCAGGCTCCCATCACC
CTCAAGCATGGCGACATCGTTCAGGGCCTCTCGTGGAATGCGGCCGGCAACATGCTCGTCACCACGTCCCGCGAC
AAGAAGATTCGCGTCTGGGACGTTCGTCAGGACAAGGCTGTCCACGAGGCTCCCGGCCACAGCGGGGCCAAGAAC
AGCAGGGTCGTCTGGATGGGCGAGCACAACCGTTTTGCCACCACCGGCTTCTCTCGCATGAGTGAGCGCCAGATC
GGCCTTTGGGAGCCGGGCAGGGTCGATCCCATCGGTGGATTCAACATGCTCGACTCCATCTCGGGTGTTTGCATT
CCTTTTTGGGACGACGGCTCCAACTGTCTCTACCTCGCCGGCAAGGGAGATGGAAATATCCGCTACTTTGAGTAC
GAGAACGACAAATTCGAGTTCCTCAGCGAATACAAGTCGCCCGACCCTCAGCGAGGAATCGCTTTCCTTCCGCGA
CGAGGCATCAACGTGCACGAGAACGAGGTGATGCGCGCCTACAAGACGGTCAGCGACACCTACATCGAGCCCATC
TCCTTCACCGTTCCCAGGCGGGCCGAGACCTTCCAGGCCGACATCTTCCCGCCCGCCATCGGCACCAAGCCGGCG
GCCACCGCCAAGGAGTGGCTCGACGGCAAGACGGGCATCCCCTCCAAGATTGATCTCGAGAGCATCTACGAAGGC
GGCGCGCCCAAGGAAGTGTCGTCGGACTATAAGCCGCCTCCCGCGCAGCCGACACCAAGGGCCGAGCCGAAGAAG
GACGAAAGCGCCAGGCGCGAGGAGCCGAAGCCGACGCCCAGTCGGGGCCCGCCTCCGTCGATGAAGGAGCAAAAG
GGGTCCATGGCCGCGGCCGCCAGCAAGTTTCAGGACGATGACGATGGGCCGGCCACGATGGACGACGAGACTTCG
AGCTTCGAGGAAGTCTCGCGCCCGACGCAACGGTCCGCCGCGGCTGTTCGCTCCGAGCCGACGCCTTCCAAGCCG
GCACCGGCCAAGGCTGCATCGTTCCCGACCAAGACGCCCTCGTCTCCTCCCGCGCCGTCGTCATCGGGCGGCGTC
GAATCGTCGCTGAGCGAGATGAGGCGTCTCATCGAGAAGCAGAGCCAGATGATGGATGCCCAGAAGGACAAGATG
GACGCCCTCGTGGCCGAGGTAGAGTCTCTCAAGAAGAAGGTCAACGCTGCTGGCCAAGACCAGTCGGAGCGCATC
CGGCAGCTGGAGCTGGAGCTCGAGTCCCGGTCGTGA
Transcript >Ophcf2|04928
ATGGCTGGCCGTTTCGTGCGGGCGTCCAAGTATCGGCACGTCTATGGAAAGTCGACGCGCAAGGAGTTTTGCTAC
GATAATCTGCACATCAGCCGCAATGCCTGGGATACGAATCTCGTCAAGGTCAACCCTTCGTACCTCTCCGTCAAC
TGGGATGCTTCGGGAGGCGGTGCCTTTGCCGTCATTCCGCTTTCCGAGAGGGGCAAGCTGCCTGATCAGATTCCG
CTCTTTCGGGGACATACGGCTGCTGTGCTCGATACCGACTGGAATCCGTTCAACGATCATCTCGTTGCCTCTGCT
TCCGAGGATGGCAAGGTCTTTCTCTGGGAGGTGCCGCAAGACTTTACTCTCCACATAGACGCCGAAGAGATTCCC
GACGTGTCCCCCGTCAGCAAGCTTGGCGGTCATTCTCGAAAAGTCGGACAGGTCTTGTTCAACCCCTCGGCCGAA
AATATCCTCGCCTCCGCCTCGGGTGACTTCTCCATCAAGATATGGGACATTGGCACCGGCCAGGCTCCCATCACC
CTCAAGCATGGCGACATCGTTCAGGGCCTCTCGTGGAATGCGGCCGGCAACATGCTCGTCACCACGTCCCGCGAC
AAGAAGATTCGCGTCTGGGACGTTCGTCAGGACAAGGCTGTCCACGAGGCTCCCGGCCACAGCGGGGCCAAGAAC
AGCAGGGTCGTCTGGATGGGCGAGCACAACCGTTTTGCCACCACCGGCTTCTCTCGCATGAGTGAGCGCCAGATC
GGCCTTTGGGAGCCGGGCAGGGTCGATCCCATCGGTGGATTCAACATGCTCGACTCCATCTCGGGTGTTTGCATT
CCTTTTTGGGACGACGGCTCCAACTGTCTCTACCTCGCCGGCAAGGGAGATGGAAATATCCGCTACTTTGAGTAC
GAGAACGACAAATTCGAGTTCCTCAGCGAATACAAGTCGCCCGACCCTCAGCGAGGAATCGCTTTCCTTCCGCGA
CGAGGCATCAACGTGCACGAGAACGAGGTGATGCGCGCCTACAAGACGGTCAGCGACACCTACATCGAGCCCATC
TCCTTCACCGTTCCCAGGCGGGCCGAGACCTTCCAGGCCGACATCTTCCCGCCCGCCATCGGCACCAAGCCGGCG
GCCACCGCCAAGGAGTGGCTCGACGGCAAGACGGGCATCCCCTCCAAGATTGATCTCGAGAGCATCTACGAAGGC
GGCGCGCCCAAGGAAGTGTCGTCGGACTATAAGCCGCCTCCCGCGCAGCCGACACCAAGGGCCGAGCCGAAGAAG
GACGAAAGCGCCAGGCGCGAGGAGCCGAAGCCGACGCCCAGTCGGGGCCCGCCTCCGTCGATGAAGGAGCAAAAG
GGGTCCATGGCCGCGGCCGCCAGCAAGTTTCAGGACGATGACGATGGGCCGGCCACGATGGACGACGAGACTTCG
AGCTTCGAGGAAGTCTCGCGCCCGACGCAACGGTCCGCCGCGGCTGTTCGCTCCGAGCCGACGCCTTCCAAGCCG
GCACCGGCCAAGGCTGCATCGTTCCCGACCAAGACGCCCTCGTCTCCTCCCGCGCCGTCGTCATCGGGCGGCGTC
GAATCGTCGCTGAGCGAGATGAGGCGTCTCATCGAGAAGCAGAGCCAGATGATGGATGCCCAGAAGGACAAGATG
GACGCCCTCGTGGCCGAGGTAGAGTCTCTCAAGAAGAAGGTCAACGCTGCTGGCCAAGACCAGTCGGAGCGCATC
CGGCAGCTGGAGCTGGAGCTCGAGTCCCGGTCGTGA
Gene >Ophcf2|04928
ATGGCTGGCCGTTTCGTGCGGGCGTCCAAGTATCGTGAGTCTTTCTTTTCCTCCTCCTCCTCCTCCTCCTCCTCC
TCCTCCTCCTCCTCACCCCCAAATCAACCTACCACGGCTGATGGAATCCCCCTTCTCCCTTCAGGGCACGTCTAT
GGAAAGTCGACGCGCAAGGAGTTTTGCTACGATAATCTGCACATCAGCCGCAATGCCTGGGATACGAATCTCGTC
AAGGTCCGCTATCGGCTTCCAGGTAGACAGGTAGCTGCCACGGCCGGCCGCTGACGTTGGGCCGCAGGTCAACCC
TTCGTACCTCTCCGTCAACTGGGATGCTTCGGGAGGCGGTGCCTTTGCCGTCATTCCGCTTTCCGAGAGGGGCAA
GCTGCCTGATCAGATTCCGCTCTTTCGGGGACATACGGCTGCTGTGCTCGATACCGACTGGTAGCCCGTTGCCTG
CCTCGTCACATCTTTGTTTCCCCTTTGCTGACTCGCATCGAGGAATCCGTTCAACGATCATCTCGTTGCCTCTGC
TTCCGAGGATGGCAAGGTCTTTCTCTGGGAGGTGCCGCAAGACTTTACTCTCCACATAGACGCCGAAGAGATTCC
CGACGTGTCCCCCGTCAGCAAGCTTGGCGGTCATTCTCGGTGTGTTTTTCTTTCCCACACATCTCCGTTTCCAAT
TCACGGCTAACGCGCAGCAGAAAAGTCGGACAGGTCTTGTTCAACCCCTCGGCCGAAAATATCCTCGCCTCCGCC
TCGGGTGACTTCTCCATCAAGATATGGGACATTGGCACCGGCCAGGCTCCCATCACCCTCAAGCATGGCGACATC
GTTCAGGGCCTCTCGTGGAATGCGGCCGGCAACATGCTCGTCACCACGTCCCGCGACAAGAAGATTCGCGTCTGG
GACGTTCGTCAGGACAAGGCTGTCCACGAGGCTCCCGGCCACAGCGGGGCCAAGAACAGCAGGGTCGTCTGGATG
GGCGAGCACAACCGTTTTGCCACCACCGGCTTCTCTCGCATGAGTGAGCGCCAGATCGGCCTTTGGGAGCCGGGC
AGGGTCGATCCCATCGGTGGATTCAACATGCTCGACTCCATCTCGGGTGTTTGCATTCCTTTTTGGGGTGAGCTT
TTCTCTATCTACTTGACAAGACGGAACTGACAAGTTGTAAAGACGACGGCTCCAACTGTCTCTACCTCGCCGGCA
AGGGGTAAGCTATCGTTTAGATGGGATGTCCAGACCTTTCTTTATCCGCTCGCTGACGATACCTCAAGAGATGGA
AATATCCGCTACTTTGAGTACGAGAACGACAAATTCGAGTTCCTCAGCGAATACAAGTCGCCCGACCCTCAGCGA
GGAATCGCTTTCCTTCCGCGACGAGGCATCAACGTGAGCTGCGCCCTCGTCCTCGTCTGACTACCAGCTGACAAT
CCGGCCAGGTGCACGAGAACGAGGTGATGCGCGCCTACAAGACGGTCAGCGACACCTACATCGAGCCCATCTCCT
TCACCGTTCCCAGGCGGGCCGAGACCTTCCAGGCCGACATCTTCCCGCCCGCCATCGGCACCAAGCCGGCGGCCA
CCGCCAAGGAGTGGCTCGACGGCAAGACGGGCATCCCCTCCAAGATTGATCTCGAGAGCATCTACGAAGGCGGCG
CGCCCAAGGAAGTGTCGTCGGACTATAAGCCGCCTCCCGCGCAGCCGACACCAAGGGCCGAGCCGAAGAAGGACG
AAAGCGCCAGGCGCGAGGAGCCGAAGCCGACGCCCAGTCGGGGCCCGCCTCCGTCGATGAAGGAGCAAAAGGGGT
CCATGGCCGCGGCCGCCAGCAAGTTTCAGGACGATGACGATGGGCCGGCCACGATGGACGACGAGACTTCGAGCT
TCGAGGAAGTCTCGCGCCCGACGCAACGGTCCGCCGCGGCTGTTCGCTCCGAGCCGACGCCTTCCAAGCCGGCAC
CGGCCAAGGCTGCATCGTTCCCGACCAAGACGCCCTCGTCTCCTCCCGCGCCGTCGTCATCGGGCGGCGTCGAAT
CGTCGCTGAGCGAGATGAGGCGTCTCATCGAGAAGCAGAGCCAGATGATGGATGCCCAGAAGGACAAGATGGACG
CCCTCGTGGCCGAGGTAGAGTCTCTCAAGAAGAAGGTCAACGCTGCTGGCCAAGACCAGTCGGAGCGCATCCGGC
AGCTGGAGCTGGAGCTCGAGTCCCGGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail