Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04914
Gene name
Locationscaffold_05:1944204..1947550
Strand-
Gene length (bp)3346
Transcript length (bp)3195
Coding sequence length (bp)3195
Protein length (aa) 1065

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 8.5E-53 119 324

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 114 136 22
3 143 165 22
4 170 192 22
5 199 221 22
6 225 244 19
7 251 273 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04914
MLLKAARLTALLTLLLLTLHLVAAQNPPPPPSSSVQPSASVKPSDAPTPSPRPDSHGETSAATQRPSTTNSTSES
TVSYSSEVHPTATRAPIGDPKFINATIPAGQLPLPPELTPGWGVAGVILLTTGMTYALVGIKNRWIHTFFSTSYI
TALGVSVLIIYVMNVPVSHAVQGGYVVAVIVSGCAVGGASMFFKELTEGLGCALGGFCLSMWLLCLVPGGMLRTV
PAKAIFNASFTLVGFALYFSRWTRDWTLIFTLAFSGATATILGLDCFSRAGLKEFWAYVWDVNNNLFPVGADTYP
VTKGIRVETAAVVIICIMGIISQIKLWRIVRDKRAKRAVERAEGRRNLELEEENVGRQVEEANARDRRHWEQVYG
NDTVVGTDSRMSDLGDMTSEKKVPDGSFKQRSSVEVIEMADMSESDLSRAAKNPLMTAAEDAEDGKVMVRVGSDD
HDQDDDGAGVEKRVLERSSASKRASMAPEVVPLPFNVPPAPTPDADQGSEGDRSSIATYAADDAEKPSAANGNNR
SGGRASLAKRSFDLLKGRASPRGGGEEVSERHLVGKTRRHDDDDDDGSLAATVDEASSSEGDDEGRRSSVCNDDD
VAELPGEEARSRGPASDGGKKLRKVSGPGGGGGADVYPAVPPSEKPKSIASVVSTSVNLTKDRLPHRMSRVAMSY
RTNEWAKHLGYAETPDPDELHLGSRSDAAAATGTGTAAAAEAAAAAPTAAIESSVPVNVVELQKTAEDGAPAPAV
IRSDSRASDRSYVASVSRRASRRGCASPTLVTPEKEVISPGRVRSPGVPTVSPPPRRPSSKFQERGAIPEEGTAP
PSIDTVQRNSLPIPSMASYINPQTLMGQREMFLRSKSQGSLFGVAAAQDPTTADNGSSPYGGASSPVGAGQDADD
VPLSQRKDFMRQSSVANLGQASSSYTMLPALASSESVENLAFNSHQPRRSLLTSSPAAREAQLANFRHSVQQDLR
SGSPIMSAPVRETVFTPVSLGNRESEVQRNIEMQRNVLMGQKEAQAQRKEAHRREREFADRAFDERMRSGDLLEA
HREAMRRMQKEARD*
Coding >Ophcf2|04914
ATGCTGCTCAAGGCGGCCCGTCTGACGGCTCTACTCACCTTGTTGCTCTTGACTCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCATCATCGTCCGTTCAGCCGTCTGCCTCGGTCAAGCCGTCCGATGCCCCGACGCCATCT
CCGCGTCCCGACTCTCATGGGGAAACTTCCGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGTCCGAGTCG
ACCGTCTCATACTCTTCCGAAGTCCATCCCACCGCCACCAGGGCTCCCATTGGAGACCCCAAGTTCATCAATGCC
ACGATCCCTGCTGGTCAGCTCCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTAATCTTGCTC
ACTACGGGCATGACCTATGCTCTCGTCGGCATCAAGAACCGATGGATTCACACCTTCTTCTCCACCTCTTACATC
ACGGCTCTCGGCGTCTCCGTCCTCATCATATACGTCATGAACGTCCCCGTCAGCCACGCAGTCCAGGGAGGATAC
GTCGTGGCCGTCATCGTCTCGGGTTGTGCCGTCGGCGGCGCCTCCATGTTTTTCAAGGAGCTGACGGAGGGTCTG
GGATGTGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCTGGCGGCATGCTCCGCACCGTC
CCAGCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACCCGGGAC
TGGACCCTCATCTTCACCCTCGCCTTCTCCGGCGCCACCGCCACCATCCTCGGTCTCGACTGCTTCAGCCGCGCC
GGCCTCAAGGAGTTTTGGGCCTACGTCTGGGACGTCAACAACAACCTGTTTCCCGTCGGCGCCGACACCTACCCG
GTGACAAAGGGGATCCGTGTCGAGACGGCCGCCGTCGTCATCATCTGCATCATGGGCATCATCTCTCAGATCAAG
CTGTGGAGGATCGTGCGGGACAAGCGGGCCAAGCGGGCCGTGGAACGGGCCGAGGGCCGGCGCAATCTCGAACTC
GAGGAGGAAAACGTCGGTCGTCAGGTCGAAGAGGCCAATGCCCGTGATCGTCGTCACTGGGAGCAGGTCTACGGC
AACGATACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGGTGCCCGAC
GGCTCTTTCAAGCAGCGCTCCTCGGTCGAGGTCATTGAGATGGCCGACATGTCCGAGTCCGATCTGTCAAGGGCG
GCCAAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAAGACGGCAAGGTCATGGTTCGCGTCGGCTCCGACGAC
CACGATCAGGACGATGACGGAGCCGGTGTCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTCT
ATGGCGCCCGAGGTGGTGCCTCTCCCGTTCAACGTGCCGCCGGCGCCGACGCCCGATGCCGATCAGGGGTCCGAG
GGCGACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGTCGGCGGCCAACGGAAATAACCGC
AGCGGCGGACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTCCTCAAGGGCCGTGCCTCGCCGCGCGGAGGAGGC
GAAGAAGTCTCGGAGCGGCACCTCGTCGGCAAGACTCGTCGACACGACGACGACGACGACGACGGGTCTCTGGCG
GCCACCGTCGACGAAGCCAGTTCCAGTGAAGGTGACGACGAGGGGAGACGCTCCTCCGTCTGCAACGACGACGAC
GTGGCCGAGCTTCCGGGAGAAGAGGCGCGGTCGCGGGGGCCGGCGTCGGACGGCGGGAAGAAGCTCCGGAAGGTA
TCGGGTCCCGGTGGCGGCGGCGGCGCCGATGTCTATCCGGCCGTTCCGCCGTCGGAGAAGCCCAAGTCGATTGCT
TCGGTCGTCTCGACGTCTGTCAATCTGACCAAAGACCGTCTGCCGCACCGCATGTCGCGCGTTGCCATGTCGTAC
CGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACTCCCGACCCGGATGAGCTGCACCTCGGCAGCCGG
TCGGATGCTGCTGCGGCGACGGGGACGGGGACGGCGGCGGCGGCGGAGGCTGCTGCTGCTGCTCCTACGGCGGCC
ATCGAGTCGTCGGTGCCCGTCAATGTGGTGGAGCTGCAGAAGACGGCCGAAGACGGAGCGCCGGCGCCGGCGGTG
ATTCGGTCGGATTCTCGGGCCTCGGACAGGTCTTACGTGGCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCTGC
GCCTCGCCCACGCTGGTGACGCCGGAAAAGGAGGTGATATCGCCGGGCCGGGTTCGGAGCCCCGGCGTACCGACG
GTGTCTCCGCCTCCTCGCCGGCCGTCGTCCAAGTTCCAGGAACGAGGGGCGATTCCCGAGGAGGGAACGGCGCCC
CCTTCGATAGACACGGTCCAGCGCAACTCGCTCCCCATCCCGAGCATGGCTTCGTACATCAACCCGCAGACGCTC
ATGGGCCAGCGCGAGATGTTCCTTCGGAGCAAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCGCCCAAGACCCG
ACCACGGCCGACAACGGCTCCTCCCCGTACGGTGGCGCGTCGTCGCCGGTAGGGGCCGGCCAGGACGCGGACGAT
GTACCGCTCAGCCAGCGCAAGGACTTTATGCGTCAGAGCAGCGTGGCCAACCTTGGCCAGGCTTCGTCGTCGTAC
ACGATGCTGCCGGCTCTGGCGTCGTCGGAGAGCGTCGAGAACCTGGCTTTCAACTCGCACCAGCCGAGGCGGTCG
CTGCTGACTTCGTCTCCGGCGGCGCGCGAGGCCCAGCTGGCCAACTTTCGACACTCTGTACAGCAGGATCTCCGA
TCGGGCTCGCCCATCATGTCGGCTCCGGTCCGTGAGACCGTCTTTACGCCCGTCTCGCTCGGCAACCGCGAGAGC
GAGGTTCAACGCAACATCGAGATGCAGCGCAACGTCCTGATGGGTCAGAAGGAGGCCCAGGCCCAGCGAAAGGAG
GCGCACCGACGGGAGAGGGAGTTTGCCGATCGGGCCTTTGATGAGCGGATGCGGTCTGGGGACCTGCTCGAGGCT
CATAGAGAGGCGATGCGCAGGATGCAAAAGGAGGCTCGAGACTGA
Transcript >Ophcf2|04914
ATGCTGCTCAAGGCGGCCCGTCTGACGGCTCTACTCACCTTGTTGCTCTTGACTCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCATCATCGTCCGTTCAGCCGTCTGCCTCGGTCAAGCCGTCCGATGCCCCGACGCCATCT
CCGCGTCCCGACTCTCATGGGGAAACTTCCGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGTCCGAGTCG
ACCGTCTCATACTCTTCCGAAGTCCATCCCACCGCCACCAGGGCTCCCATTGGAGACCCCAAGTTCATCAATGCC
ACGATCCCTGCTGGTCAGCTCCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTAATCTTGCTC
ACTACGGGCATGACCTATGCTCTCGTCGGCATCAAGAACCGATGGATTCACACCTTCTTCTCCACCTCTTACATC
ACGGCTCTCGGCGTCTCCGTCCTCATCATATACGTCATGAACGTCCCCGTCAGCCACGCAGTCCAGGGAGGATAC
GTCGTGGCCGTCATCGTCTCGGGTTGTGCCGTCGGCGGCGCCTCCATGTTTTTCAAGGAGCTGACGGAGGGTCTG
GGATGTGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCTGGCGGCATGCTCCGCACCGTC
CCAGCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACCCGGGAC
TGGACCCTCATCTTCACCCTCGCCTTCTCCGGCGCCACCGCCACCATCCTCGGTCTCGACTGCTTCAGCCGCGCC
GGCCTCAAGGAGTTTTGGGCCTACGTCTGGGACGTCAACAACAACCTGTTTCCCGTCGGCGCCGACACCTACCCG
GTGACAAAGGGGATCCGTGTCGAGACGGCCGCCGTCGTCATCATCTGCATCATGGGCATCATCTCTCAGATCAAG
CTGTGGAGGATCGTGCGGGACAAGCGGGCCAAGCGGGCCGTGGAACGGGCCGAGGGCCGGCGCAATCTCGAACTC
GAGGAGGAAAACGTCGGTCGTCAGGTCGAAGAGGCCAATGCCCGTGATCGTCGTCACTGGGAGCAGGTCTACGGC
AACGATACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGGTGCCCGAC
GGCTCTTTCAAGCAGCGCTCCTCGGTCGAGGTCATTGAGATGGCCGACATGTCCGAGTCCGATCTGTCAAGGGCG
GCCAAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAAGACGGCAAGGTCATGGTTCGCGTCGGCTCCGACGAC
CACGATCAGGACGATGACGGAGCCGGTGTCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTCT
ATGGCGCCCGAGGTGGTGCCTCTCCCGTTCAACGTGCCGCCGGCGCCGACGCCCGATGCCGATCAGGGGTCCGAG
GGCGACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGTCGGCGGCCAACGGAAATAACCGC
AGCGGCGGACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTCCTCAAGGGCCGTGCCTCGCCGCGCGGAGGAGGC
GAAGAAGTCTCGGAGCGGCACCTCGTCGGCAAGACTCGTCGACACGACGACGACGACGACGACGGGTCTCTGGCG
GCCACCGTCGACGAAGCCAGTTCCAGTGAAGGTGACGACGAGGGGAGACGCTCCTCCGTCTGCAACGACGACGAC
GTGGCCGAGCTTCCGGGAGAAGAGGCGCGGTCGCGGGGGCCGGCGTCGGACGGCGGGAAGAAGCTCCGGAAGGTA
TCGGGTCCCGGTGGCGGCGGCGGCGCCGATGTCTATCCGGCCGTTCCGCCGTCGGAGAAGCCCAAGTCGATTGCT
TCGGTCGTCTCGACGTCTGTCAATCTGACCAAAGACCGTCTGCCGCACCGCATGTCGCGCGTTGCCATGTCGTAC
CGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACTCCCGACCCGGATGAGCTGCACCTCGGCAGCCGG
TCGGATGCTGCTGCGGCGACGGGGACGGGGACGGCGGCGGCGGCGGAGGCTGCTGCTGCTGCTCCTACGGCGGCC
ATCGAGTCGTCGGTGCCCGTCAATGTGGTGGAGCTGCAGAAGACGGCCGAAGACGGAGCGCCGGCGCCGGCGGTG
ATTCGGTCGGATTCTCGGGCCTCGGACAGGTCTTACGTGGCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCTGC
GCCTCGCCCACGCTGGTGACGCCGGAAAAGGAGGTGATATCGCCGGGCCGGGTTCGGAGCCCCGGCGTACCGACG
GTGTCTCCGCCTCCTCGCCGGCCGTCGTCCAAGTTCCAGGAACGAGGGGCGATTCCCGAGGAGGGAACGGCGCCC
CCTTCGATAGACACGGTCCAGCGCAACTCGCTCCCCATCCCGAGCATGGCTTCGTACATCAACCCGCAGACGCTC
ATGGGCCAGCGCGAGATGTTCCTTCGGAGCAAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCGCCCAAGACCCG
ACCACGGCCGACAACGGCTCCTCCCCGTACGGTGGCGCGTCGTCGCCGGTAGGGGCCGGCCAGGACGCGGACGAT
GTACCGCTCAGCCAGCGCAAGGACTTTATGCGTCAGAGCAGCGTGGCCAACCTTGGCCAGGCTTCGTCGTCGTAC
ACGATGCTGCCGGCTCTGGCGTCGTCGGAGAGCGTCGAGAACCTGGCTTTCAACTCGCACCAGCCGAGGCGGTCG
CTGCTGACTTCGTCTCCGGCGGCGCGCGAGGCCCAGCTGGCCAACTTTCGACACTCTGTACAGCAGGATCTCCGA
TCGGGCTCGCCCATCATGTCGGCTCCGGTCCGTGAGACCGTCTTTACGCCCGTCTCGCTCGGCAACCGCGAGAGC
GAGGTTCAACGCAACATCGAGATGCAGCGCAACGTCCTGATGGGTCAGAAGGAGGCCCAGGCCCAGCGAAAGGAG
GCGCACCGACGGGAGAGGGAGTTTGCCGATCGGGCCTTTGATGAGCGGATGCGGTCTGGGGACCTGCTCGAGGCT
CATAGAGAGGCGATGCGCAGGATGCAAAAGGAGGCTCGAGACTGA
Gene >Ophcf2|04914
ATGCTGCTCAAGGCGGCCCGTCTGACGGCTCTACTCACCTTGTTGCTCTTGACTCTGCACCTGGTCGCCGCTCAG
AACCCGCCGCCGCCGCCATCATCGTCCGTTCAGCCGTCTGCCTCGGTCAAGCCGTCCGATGCCCCGACGCCATCT
CCGCGTCCCGACTCTCATGGGGAAACTTCCGGTATCTCATCGGCCCCCTGAACGCCTCTCCCGCTTCCCACCTCC
CGTCTTCGTCACTGATGCCTGGTCCCACGCAGCTGCTACCCAAAGACCCTCCACCACCAACTCTACGTCCGAGTC
GACCGTCTCATACTCTTCCGAAGTCCATCCCACCGCCACCAGGGCTCCCATTGGAGACCCCAAGTTCATCAATGG
TATAATCCCCTGCTCCCCTTTTGCCCCCCCCCCCCCCCTCCTTTTCCCTCCCTGACCTCGTCTCTTCCGCACAGC
CACGATCCCTGCTGGTCAGCTCCCGCTCCCGCCGGAGCTCACTCCGGGCTGGGGCGTTGCCGGCGTAATCTTGCT
CACTACGGGCATGACCTATGCTCTCGTCGGCATCAAGAACCGATGGATTCACACCTTCTTCTCCACCTCTTACAT
CACGGCTCTCGGCGTCTCCGTCCTCATCATATACGTCATGAACGTCCCCGTCAGCCACGCAGTCCAGGGAGGATA
CGTCGTGGCCGTCATCGTCTCGGGTTGTGCCGTCGGCGGCGCCTCCATGTTTTTCAAGGAGCTGACGGAGGGTCT
GGGATGTGCTCTCGGCGGCTTCTGTCTCAGCATGTGGCTGCTCTGTCTGGTGCCTGGCGGCATGCTCCGCACCGT
CCCAGCAAAGGCCATCTTCAACGCCTCCTTCACCCTCGTCGGCTTCGCCCTGTACTTTAGCCGCTGGACCCGGGA
CTGGACCCTCATCTTCACCCTCGCCTTCTCCGGCGCCACCGCCACCATCCTCGGTCTCGACTGCTTCAGCCGCGC
CGGCCTCAAGGAGTTTTGGGCCTACGTCTGGGACGTCAACAACAACCTGTTTCCCGTCGGCGCCGACACCTACCC
GGTGACAAAGGGGATCCGTGTCGAGACGGCCGCCGTCGTCATCATCTGCATCATGGGCATCATCTCTCAGATCAA
GCTGTGGAGGATCGTGCGGGACAAGCGGGCCAAGCGGGCCGTGGAACGGGCCGAGGGCCGGCGCAATCTCGAACT
CGAGGAGGAAAACGTCGGTCGTCAGGTCGAAGAGGCCAATGCCCGTGATCGTCGTCACTGGGAGCAGGTCTACGG
CAACGATACCGTCGTCGGCACCGACTCGCGCATGTCGGACCTGGGCGACATGACGAGCGAGAAAAAGGTGCCCGA
CGGCTCTTTCAAGCAGCGCTCCTCGGTCGAGGTCATTGAGATGGCCGACATGTCCGAGTCCGATCTGTCAAGGGC
GGCCAAGAACCCGCTCATGACGGCTGCCGAGGACGCCGAAGACGGCAAGGTCATGGTTCGCGTCGGCTCCGACGA
CCACGATCAGGACGATGACGGAGCCGGTGTCGAGAAGCGCGTCTTGGAGCGGTCCTCGGCCAGCAAGAGAGCCTC
TATGGCGCCCGAGGTGGTGCCTCTCCCGTTCAACGTGCCGCCGGCGCCGACGCCCGATGCCGATCAGGGGTCCGA
GGGCGACCGGTCGTCGATTGCTACGTATGCCGCCGACGACGCCGAGAAGCCGTCGGCGGCCAACGGAAATAACCG
CAGCGGCGGACGGGCCTCGCTGGCCAAGCGCTCCTTTGACCTCCTCAAGGGCCGTGCCTCGCCGCGCGGAGGAGG
CGAAGAAGTCTCGGAGCGGCACCTCGTCGGCAAGACTCGTCGACACGACGACGACGACGACGACGGGTCTCTGGC
GGCCACCGTCGACGAAGCCAGTTCCAGTGAAGGTGACGACGAGGGGAGACGCTCCTCCGTCTGCAACGACGACGA
CGTGGCCGAGCTTCCGGGAGAAGAGGCGCGGTCGCGGGGGCCGGCGTCGGACGGCGGGAAGAAGCTCCGGAAGGT
ATCGGGTCCCGGTGGCGGCGGCGGCGCCGATGTCTATCCGGCCGTTCCGCCGTCGGAGAAGCCCAAGTCGATTGC
TTCGGTCGTCTCGACGTCTGTCAATCTGACCAAAGACCGTCTGCCGCACCGCATGTCGCGCGTTGCCATGTCGTA
CCGCACCAACGAATGGGCCAAGCATCTCGGGTATGCCGAGACTCCCGACCCGGATGAGCTGCACCTCGGCAGCCG
GTCGGATGCTGCTGCGGCGACGGGGACGGGGACGGCGGCGGCGGCGGAGGCTGCTGCTGCTGCTCCTACGGCGGC
CATCGAGTCGTCGGTGCCCGTCAATGTGGTGGAGCTGCAGAAGACGGCCGAAGACGGAGCGCCGGCGCCGGCGGT
GATTCGGTCGGATTCTCGGGCCTCGGACAGGTCTTACGTGGCCAGCGTCTCTCGTCGTGCCTCCCGAAGGGGCTG
CGCCTCGCCCACGCTGGTGACGCCGGAAAAGGAGGTGATATCGCCGGGCCGGGTTCGGAGCCCCGGCGTACCGAC
GGTGTCTCCGCCTCCTCGCCGGCCGTCGTCCAAGTTCCAGGAACGAGGGGCGATTCCCGAGGAGGGAACGGCGCC
CCCTTCGATAGACACGGTCCAGCGCAACTCGCTCCCCATCCCGAGCATGGCTTCGTACATCAACCCGCAGACGCT
CATGGGCCAGCGCGAGATGTTCCTTCGGAGCAAGTCACAGGGGAGCCTGTTCGGAGTCGCCGCCGCCCAAGACCC
GACCACGGCCGACAACGGCTCCTCCCCGTACGGTGGCGCGTCGTCGCCGGTAGGGGCCGGCCAGGACGCGGACGA
TGTACCGCTCAGCCAGCGCAAGGACTTTATGCGTCAGAGCAGCGTGGCCAACCTTGGCCAGGCTTCGTCGTCGTA
CACGATGCTGCCGGCTCTGGCGTCGTCGGAGAGCGTCGAGAACCTGGCTTTCAACTCGCACCAGCCGAGGCGGTC
GCTGCTGACTTCGTCTCCGGCGGCGCGCGAGGCCCAGCTGGCCAACTTTCGACACTCTGTACAGCAGGATCTCCG
ATCGGGCTCGCCCATCATGTCGGCTCCGGTCCGTGAGACCGTCTTTACGCCCGTCTCGCTCGGCAACCGCGAGAG
CGAGGTTCAACGCAACATCGAGATGCAGCGCAACGTCCTGATGGGTCAGAAGGAGGCCCAGGCCCAGCGAAAGGA
GGCGCACCGACGGGAGAGGGAGTTTGCCGATCGGGCCTTTGATGAGCGGATGCGGTCTGGGGACCTGCTCGAGGC
TCATAGAGAGGCGATGCGCAGGATGCAAAAGGAGGCTCGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail