Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04893
Gene name
Locationscaffold_05:1894217..1895892
Strand+
Gene length (bp)1675
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 3.2E-35 271 412

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0004175 endopeptidase activity No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 275 297 22
3 314 336 22
4 340 359 19
5 371 390 19
6 455 477 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 33.31 18.05 48.57
Alive In ants, during behavior modification 58.95 33.15 84.74
Dead In ants, recently dead 45.70 25.64 65.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000851 yes
Alive Dead 0.126993 no
Dead Fungus 0.102699 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04893
MAFNEGLKASPFRSDDRLRDPAPSPYDAAHFPSSSPRLTPAPSFHSVDPVRPSQTPRLGHSPFETVFDDPVRLNA
PKSHAAGSSSPALHHDTGYYGPSAGPHVAEEIPLQDHPASKNDGVTDHVYDALGPDGNARPSAAPRRSRGKVRIG
ELGMFGANRKRIPWVVYFFTAVQVIVFIAEIIRNGVLTGSPIMIKPQFNPMIGPSTQVMINMGARFVACMHNVPE
IQGSNIPVLFLCPNATSNDQTCPLSEVCGFGGVPDPTFNNADQKPEPNQWFRFITPIFMHAGLVHIGFNLLLQLT
LAKEMEMAIGPMRFFLVYMSAGIFGFVLGGNFAAPALPSTGASGSLFGIIALVLLDLLYSWKERRNPVKDLLYLI
LDMVISFALGLLPGLDNFAHIGGFIMGLALGICVLHSPNSLRKRLGNDTPYSAVLPDNSSPPMQRFKGPIGFFKG
RKPLWWLWWIVRAAVLTVAIAVFIVLLNNFYTTRTRCTWCKYLSCIPVSNWCDIGTIRQES*
Coding >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCC
ATGATCGGCCCTTCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAG
ATTCAGGGGTCCAACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCC
GAAGTCTGCGGCTTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGG
TTCCGCTTCATCACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACG
CTCGCCAAGGAGATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGC
TTCGTCCTCGGTGGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATT
GCCTTGGTCCTCCTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATC
CTCGACATGGTCATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATC
ATGGGTCTGGCCCTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCC
TACTCGGCCGTCCTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGA
CGCAAGCCGCTGTGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTC
CTGCTCAACAACTTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTCCCGTCAGCAAC
TGGTGTGATATTGGAACTATTCGTCAAGAGAGCTGA
Transcript >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCC
ATGATCGGCCCTTCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAG
ATTCAGGGGTCCAACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCC
GAAGTCTGCGGCTTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGG
TTCCGCTTCATCACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACG
CTCGCCAAGGAGATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGC
TTCGTCCTCGGTGGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATT
GCCTTGGTCCTCCTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATC
CTCGACATGGTCATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATC
ATGGGTCTGGCCCTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCC
TACTCGGCCGTCCTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGA
CGCAAGCCGCTGTGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTC
CTGCTCAACAACTTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTCCCGTCAGCAAC
TGGTGTGATATTGGAACTATTCGTCAAGAGAGCTGA
Gene >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGTACGACTCCTCTTCCTTTTGCTAGTGTCGTTGATGATTGTGCTGAC
GTCTTCGGTTTGCAAGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCCATGATCGGCCCT
TCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAGATTCAGGGGTCC
AACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCCGAAGTCTGCGGC
TTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGGTTCCGCTTCATC
ACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACGCTCGCCAAGGAG
ATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGCTTCGTCCTCGGT
GGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATTGCCTTGGTCCTC
CTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATCCTCGACATGGTC
ATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATCATGGGTCTGGCC
CTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCCTACTCGGCCGTC
CTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGACGCAAGCCGCTG
TGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTCCTGCTCAACAAC
TTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTGTGCGTTCCCCCTTTTACCTTTTT
TTTTTTCTATACATCTATCAAGGTTGGTGACAGGCTAACTGATGAACTACAGCCCGTCAGCAACTGGTGTGATAT
TGGAACTATTCGTCAAGAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail