Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04893
Gene name
Locationscaffold_05:1894217..1895892
Strand+
Gene length (bp)1675
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 3.2E-35 271 412

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0004175 endopeptidase activity No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 275 297 22
3 314 336 22
4 340 359 19
5 371 390 19
6 455 477 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04893
MAFNEGLKASPFRSDDRLRDPAPSPYDAAHFPSSSPRLTPAPSFHSVDPVRPSQTPRLGHSPFETVFDDPVRLNA
PKSHAAGSSSPALHHDTGYYGPSAGPHVAEEIPLQDHPASKNDGVTDHVYDALGPDGNARPSAAPRRSRGKVRIG
ELGMFGANRKRIPWVVYFFTAVQVIVFIAEIIRNGVLTGSPIMIKPQFNPMIGPSTQVMINMGARFVACMHNVPE
IQGSNIPVLFLCPNATSNDQTCPLSEVCGFGGVPDPTFNNADQKPEPNQWFRFITPIFMHAGLVHIGFNLLLQLT
LAKEMEMAIGPMRFFLVYMSAGIFGFVLGGNFAAPALPSTGASGSLFGIIALVLLDLLYSWKERRNPVKDLLYLI
LDMVISFALGLLPGLDNFAHIGGFIMGLALGICVLHSPNSLRKRLGNDTPYSAVLPDNSSPPMQRFKGPIGFFKG
RKPLWWLWWIVRAAVLTVAIAVFIVLLNNFYTTRTRCTWCKYLSCIPVSNWCDIGTIRQES*
Coding >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCC
ATGATCGGCCCTTCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAG
ATTCAGGGGTCCAACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCC
GAAGTCTGCGGCTTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGG
TTCCGCTTCATCACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACG
CTCGCCAAGGAGATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGC
TTCGTCCTCGGTGGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATT
GCCTTGGTCCTCCTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATC
CTCGACATGGTCATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATC
ATGGGTCTGGCCCTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCC
TACTCGGCCGTCCTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGA
CGCAAGCCGCTGTGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTC
CTGCTCAACAACTTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTCCCGTCAGCAAC
TGGTGTGATATTGGAACTATTCGTCAAGAGAGCTGA
Transcript >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCC
ATGATCGGCCCTTCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAG
ATTCAGGGGTCCAACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCC
GAAGTCTGCGGCTTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGG
TTCCGCTTCATCACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACG
CTCGCCAAGGAGATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGC
TTCGTCCTCGGTGGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATT
GCCTTGGTCCTCCTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATC
CTCGACATGGTCATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATC
ATGGGTCTGGCCCTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCC
TACTCGGCCGTCCTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGA
CGCAAGCCGCTGTGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTC
CTGCTCAACAACTTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTCCCGTCAGCAAC
TGGTGTGATATTGGAACTATTCGTCAAGAGAGCTGA
Gene >Ophcf2|04893
ATGGCCTTCAATGAGGGCCTCAAAGCCAGCCCCTTCAGGAGTGACGACCGTCTGCGAGATCCGGCTCCCTCGCCC
TACGATGCCGCTCACTTCCCGTCCTCGTCGCCTCGTCTGACGCCCGCGCCCTCATTCCACTCGGTCGACCCCGTG
CGGCCCTCGCAGACGCCACGCCTGGGTCATTCTCCCTTTGAGACCGTCTTCGACGACCCTGTTCGCCTCAATGCG
CCCAAGTCCCACGCCGCTGGCTCGTCTTCGCCCGCGCTCCACCATGACACTGGCTACTATGGCCCGTCGGCTGGC
CCGCACGTGGCCGAAGAGATACCGCTGCAGGACCATCCGGCTTCCAAGAACGACGGCGTGACGGATCATGTGTAC
GATGCGCTGGGTCCCGACGGCAATGCGAGGCCGTCTGCTGCACCGAGACGCAGCAGAGGCAAGGTCCGCATAGGC
GAGCTGGGAATGTTTGGCGCAAACAGGAAGCGCATTCCCTGGGTCGTCTACTTCTTCACCGCCGTCCAGGTCATC
GTCTTCATCGCCGAGATTATCAGGAATGGTACGACTCCTCTTCCTTTTGCTAGTGTCGTTGATGATTGTGCTGAC
GTCTTCGGTTTGCAAGGCGTCCTGACGGGATCGCCCATCATGATCAAGCCCCAATTCAACCCCATGATCGGCCCT
TCGACCCAAGTCATGATCAACATGGGCGCCCGTTTCGTTGCCTGCATGCACAACGTGCCCGAGATTCAGGGGTCC
AACATCCCGGTCCTCTTCCTCTGCCCCAACGCGACGAGCAACGACCAGACGTGTCCGCTCTCCGAAGTCTGCGGC
TTCGGCGGCGTCCCTGACCCAACTTTCAACAACGCGGACCAGAAGCCGGAACCCAACCAGTGGTTCCGCTTCATC
ACGCCCATCTTCATGCACGCCGGCCTCGTCCACATCGGCTTCAACTTGCTACTACAGCTCACGCTCGCCAAGGAG
ATGGAGATGGCCATCGGGCCCATGCGCTTCTTTCTCGTCTACATGAGCGCCGGTATCTTTGGCTTCGTCCTCGGT
GGCAATTTCGCCGCACCCGCGCTGCCCTCGACCGGCGCATCGGGCTCCCTGTTTGGCATCATTGCCTTGGTCCTC
CTCGACCTCCTCTACTCGTGGAAAGAGCGTCGCAACCCGGTCAAAGACCTGTTATATCTCATCCTCGACATGGTC
ATCTCATTCGCGCTCGGTCTCTTGCCGGGTCTCGACAATTTCGCTCACATCGGCGGCTTCATCATGGGTCTGGCC
CTCGGTATCTGCGTCCTGCATTCTCCCAACTCGCTGCGCAAGCGCCTAGGCAACGACACGCCCTACTCGGCCGTC
CTCCCCGACAACAGCTCCCCACCGATGCAGCGCTTCAAGGGGCCCATCGGCTTCTTCAAGGGACGCAAGCCGCTG
TGGTGGCTGTGGTGGATCGTCCGGGCCGCCGTCCTGACCGTAGCCATCGCCGTCTTCATCGTCCTGCTCAACAAC
TTTTATACGACGCGGACTAGGTGCACCTGGTGCAAGTACCTGAGCTGCATTGTGCGTTCCCCCTTTTACCTTTTT
TTTTTTCTATACATCTATCAAGGTTGGTGACAGGCTAACTGATGAACTACAGCCCGTCAGCAACTGGTGTGATAT
TGGAACTATTCGTCAAGAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail