Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04891
Gene name
Locationscaffold_05:1884772..1889846
Strand+
Gene length (bp)5074
Transcript length (bp)4890
Coding sequence length (bp)4890
Protein length (aa) 1630

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11864 DUF3384 Domain of unknown function (DUF3384) 4.8E-139 118 591
PF02145 Rap_GAP Rap/ran-GAP 1.5E-53 1326 1527
PF03542 Tuberin Tuberin 4.4E-30 880 1076

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0043547 positive regulation of GTPase activity Yes
GO:0051056 regulation of small GTPase mediated signal transduction Yes
GO:0098772 molecular function regulator activity No
GO:0050794 regulation of cellular process No
GO:0043087 regulation of GTPase activity No
GO:0050789 regulation of biological process No
GO:0030695 GTPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0065009 regulation of molecular function No
GO:0048583 regulation of response to stimulus No
GO:0008047 enzyme activator activity No
GO:0051345 positive regulation of hydrolase activity No
GO:0050790 regulation of catalytic activity No
GO:0009966 regulation of signal transduction No
GO:0043085 positive regulation of catalytic activity No
GO:0023051 regulation of signaling No
GO:0051336 regulation of hydrolase activity No
GO:0003674 molecular_function No
GO:0044093 positive regulation of molecular function No
GO:0065007 biological regulation No
GO:0030234 enzyme regulator activity No
GO:1902531 regulation of intracellular signal transduction No
GO:0008150 biological_process No
GO:0010646 regulation of cell communication No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6566 0.4231 0.0864 0.1484 0.1078 0.0097 0.2124 0.2966 0.3372 0.0211

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3266
Ophiocordyceps australis map64 (Brazil) OphauB2|8033
Ophiocordyceps camponoti-floridani Ophcf2|04891 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5204
Ophiocordyceps kimflemingae Ophio5|5715
Ophiocordyceps subramaniannii Hirsu2|6409

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04891
MPTPKQAARFHLSSPCCPEELSLPPRLSSAVKIKASSAEHMSPQPEDDTSSPSSARQGGFGNVFRTLTISRGDRT
LHNLPSAAPQPRTEIVHAGSSSSRELSTNHRDALELLRSDVPSDRISAASTLKYAIAEYPVNPVLDIWYAAKDMI
EPANPVTMRTAGWELLTECAKHPSSTDLERREYFQTLSATASQEDFHLQLAALVDLSKGGRAVSGFGYDLVPLLT
GWLQGAYKTARKARRNAQSTRGQRSSSRGRAAASGEEKNLTQLFQFFHDVIKFSFNNANEASVTELLDSLLVICM
NTSVEDDLQSCISILDAIVTFGAIPPHKLKDCVQVLASIFCMVPALQKKSWHNIANLCKSHNGQAVVRVMLDILR
NRPADGLGDKDTSREVKGSIAVLQKLLSKSAEKGYPTVPFAPLVDGLSNTLRASSSPRVYAALLQLINFLFDDGG
GKTHRVIVDEDWSGCLDVAAECGKRMNGDADRRRGSSPAKEEAPEAVVDRELMKLIRRLDDIVKDKSGDFVPRET
IIRFFADVNFLLPDATVRTVLDYFQEFRCCSPSDLRWEENLSLVLEAFFSNPRLSSTTRLRALQTTMDAYEIVDL
VGDGAEQNLIPRLAESVLRNVSQETDLSVLEAVMSLMTSVIESCDMELFSYVIDRLKEIVLNDRTRSPMSSPSTP
AVQSPSASGAVPAAADQSSSSVVTRCFVKMFLRVVNSHGEKSVRLFNALVAVARTSHCEVDARLEAMKLLFRLRA
DWANRVFVTDDVENSFLANAMCRTEASIVRKQAEETAQSFRLSKSEHVAQSRPSRGISFGQGPAHERALPVRTPS
GVKSVQQRYCQMWSYPDAAALPDAMPKLISPILVSRASPVADDGLCPSGEVRAPQNSALNMSAWLSAVLVVLQGS
DWEVYSFALVHLPSQLSNHAIFRDAIPQIQELRRIICEQIRTNGFQEPPFVTGLRRADVAICLFHSLTMILSYHE
HFTKSEEDDIVKTFAYGIAAWERTAKYCIHALSICCHELPLSTSKCLIQVLNQMAAIITQPHVSVHILEFLASLS
RLHDVFVNFREEDYRIVFGICFRYLEYAREKRQSNRSSHVSEASAPVTPGSTAADGTASDELPQYVHAMAYHVIL
FWFLALKLQDRAHHVGWIVRKLFADGDGYGQAADDQALTSIDFMQRVAFADVGESAEDPYFSEDRFGAINKKQWL
LGNSIITIKQAAASGWAQIIKRQPSGTSAYTVRESLRPPPPHQTEAHVDVSREGRPTSNAVLPSHLLVQLMAPVP
QTFESARPIPLPQDEAVERAIRVFDRNSSLDGHKVGVIYIGEGQTREADILANVIGSRDYLAFLNTLGTLTKLKG
ATFNTQGLDREYDSDGEYTFCWRDRVTEIVFHVTTQMPTDLERDAQCTMKKRHIGNDFVSIIFNDSGLPFRFDTF
PSQFNFVNIVITPASRASFIAMREAEASLGRRQPFYRVQVMSKPGFPEVSPASETKMISLKALAGFVRLLALNAS
MFSVVWHNQEGGEHISSWSARLREIKRLRDRYGPKAAAAAATTTTTASSPPGTALSGGQQPEAARAGTSVRDSLS
SLRRTSVATFFTSASEQASHRSSTLSTSAASNDTELPVAANPLVESVDFSKWAR*
Coding >Ophcf2|04891
ATGCCCACCCCAAAGCAAGCAGCTCGCTTTCACCTCTCGAGCCCATGTTGTCCTGAGGAGCTCTCTCTTCCTCCG
AGGCTATCCTCGGCTGTCAAAATCAAAGCATCCTCAGCCGAGCACATGTCCCCGCAGCCCGAAGATGATACTTCG
TCGCCCAGCTCGGCACGCCAAGGAGGCTTTGGCAACGTTTTCCGCACTCTGACCATTTCCAGAGGTGACAGGACG
CTGCACAATCTTCCCTCGGCCGCCCCCCAACCGAGGACAGAGATCGTCCATGCCGGTTCTTCGAGCTCTCGCGAG
CTGTCGACCAACCACAGGGATGCCTTGGAGCTCCTCAGGAGCGATGTGCCCAGCGACCGAATCTCCGCCGCTAGC
ACCCTCAAGTACGCCATCGCCGAGTATCCTGTGAACCCTGTCCTCGACATTTGGTACGCCGCCAAAGATATGATT
GAGCCCGCCAACCCGGTTACCATGCGTACGGCGGGCTGGGAGCTTTTGACCGAGTGTGCCAAGCATCCATCTTCT
ACAGATCTTGAGCGAAGGGAGTATTTCCAAACCCTGTCTGCGACCGCTAGCCAGGAAGACTTTCATCTGCAGCTT
GCTGCCCTTGTCGATCTCAGCAAAGGTGGCCGCGCCGTATCGGGCTTTGGCTACGATCTCGTTCCGCTTTTGACG
GGTTGGCTGCAAGGGGCCTACAAGACGGCTCGCAAGGCTCGTAGGAACGCCCAGTCGACTCGAGGTCAAAGAAGC
TCGTCTAGGGGCAGAGCAGCGGCATCTGGCGAAGAGAAGAATCTAACGCAGCTCTTCCAGTTCTTCCACGATGTC
ATCAAATTCAGCTTCAACAATGCAAACGAAGCATCCGTCACGGAGCTTCTCGATAGCCTCCTCGTCATATGCATG
AACACAAGCGTGGAAGACGACCTCCAGTCCTGCATCAGTATACTCGACGCCATCGTGACCTTTGGGGCGATTCCT
CCCCACAAGCTCAAGGACTGCGTTCAGGTTCTTGCCTCTATTTTCTGCATGGTGCCCGCTTTGCAGAAGAAGTCG
TGGCACAACATTGCAAACCTTTGCAAGTCTCACAATGGCCAAGCTGTCGTACGCGTCATGCTGGACATTCTCCGT
AACCGTCCCGCCGACGGACTCGGTGACAAGGATACGAGCAGAGAAGTTAAAGGCTCCATTGCGGTGCTGCAGAAA
CTGCTGTCAAAGTCGGCTGAAAAGGGGTATCCGACCGTGCCGTTTGCGCCGCTCGTTGACGGTCTATCCAACACG
CTGAGGGCATCATCGTCCCCTCGAGTCTACGCTGCCCTTCTCCAGCTGATCAACTTTCTGTTTGACGACGGGGGC
GGCAAGACTCACCGCGTCATCGTGGACGAGGACTGGTCAGGGTGTCTCGACGTAGCGGCCGAATGCGGGAAAAGG
ATGAATGGCGATGCAGACAGGAGACGAGGCAGCAGTCCTGCCAAGGAAGAGGCCCCGGAGGCGGTGGTCGACCGC
GAGCTCATGAAGCTCATCCGCAGGCTCGACGACATTGTCAAAGACAAGTCGGGCGACTTTGTGCCACGAGAGACC
ATCATCAGGTTCTTCGCGGACGTCAACTTTCTCCTGCCGGACGCGACGGTGAGAACGGTATTGGACTACTTTCAA
GAGTTTCGATGCTGTTCGCCTTCCGACCTCCGATGGGAAGAGAATCTGTCGTTGGTTTTGGAGGCCTTCTTCAGC
AACCCGAGGCTGAGCTCGACCACGCGGCTACGGGCGTTGCAGACCACCATGGACGCGTACGAAATCGTCGATCTC
GTCGGCGACGGTGCGGAGCAGAACCTGATTCCCCGCCTGGCCGAGAGCGTCCTCAGGAACGTATCGCAAGAGACC
GACTTGTCCGTGCTGGAGGCCGTCATGTCGCTCATGACGTCCGTCATCGAGTCCTGCGACATGGAGTTGTTCAGC
TACGTGATTGACAGGCTCAAGGAAATCGTCCTCAACGACCGAACCAGGTCGCCCATGTCGTCCCCGTCAACTCCT
GCAGTTCAGTCCCCTTCGGCATCTGGCGCGGTCCCCGCTGCCGCAGACCAGTCGTCGTCCAGCGTGGTGACGCGC
TGCTTCGTCAAGATGTTCCTTCGGGTCGTCAACTCACACGGGGAGAAGAGCGTGCGACTGTTCAACGCGCTTGTG
GCCGTCGCTAGGACGAGCCACTGCGAGGTCGACGCTCGGCTAGAGGCGATGAAGCTACTGTTTCGATTACGCGCC
GACTGGGCTAATCGTGTCTTTGTTACCGATGATGTCGAGAACAGCTTCCTGGCCAACGCCATGTGTCGAACAGAG
GCTTCCATCGTTAGGAAGCAGGCTGAGGAGACGGCACAATCCTTCAGGCTGTCCAAGAGCGAGCACGTGGCTCAG
TCCCGTCCTTCACGCGGCATATCATTCGGTCAGGGGCCGGCGCACGAGAGGGCTCTCCCGGTTCGCACGCCGAGC
GGTGTCAAGAGCGTGCAGCAAAGGTATTGCCAGATGTGGAGTTATCCCGATGCTGCCGCTCTTCCAGACGCGATG
CCCAAGCTCATCAGCCCCATCTTGGTCTCCCGCGCATCGCCCGTTGCCGACGATGGCCTCTGTCCCAGTGGCGAA
GTCAGGGCTCCGCAGAACTCTGCGCTCAACATGTCGGCGTGGCTCAGCGCCGTCTTGGTCGTTCTTCAGGGAAGC
GACTGGGAGGTGTACAGCTTCGCACTGGTTCATCTGCCGTCGCAGCTCAGCAACCATGCCATCTTTAGGGATGCG
ATCCCACAGATCCAAGAGCTCCGGAGGATCATCTGCGAGCAGATCCGGACAAACGGCTTCCAGGAGCCGCCGTTT
GTCACGGGACTTCGCCGCGCCGACGTGGCAATCTGTCTGTTCCACAGCTTGACCATGATCCTAAGCTATCACGAG
CATTTCACCAAGAGCGAAGAGGACGACATCGTCAAGACGTTTGCCTACGGTATCGCTGCTTGGGAGCGGACGGCC
AAGTACTGCATCCACGCCCTGTCCATCTGCTGCCACGAGCTGCCGCTATCGACGAGCAAGTGCCTGATCCAGGTG
CTGAACCAGATGGCGGCCATCATCACGCAGCCCCACGTCTCGGTTCATATCCTCGAGTTTCTGGCCTCGCTGAGC
CGCCTTCACGACGTCTTTGTCAACTTCCGGGAGGAAGACTATCGCATCGTGTTTGGCATCTGCTTCCGCTACCTC
GAGTACGCCAGAGAGAAGCGGCAGTCGAACCGCAGCAGCCATGTAAGCGAAGCCTCTGCGCCCGTGACGCCGGGT
TCGACTGCTGCCGATGGGACCGCTTCGGATGAACTTCCGCAATACGTGCACGCTATGGCCTATCACGTCATACTG
TTTTGGTTTCTTGCGCTGAAGCTCCAGGATCGAGCCCACCACGTGGGGTGGATCGTCAGGAAGCTCTTCGCCGAC
GGCGACGGCTACGGACAAGCGGCCGACGACCAGGCGCTGACGTCGATTGACTTCATGCAGAGAGTCGCCTTCGCC
GACGTTGGCGAGTCGGCCGAGGACCCCTACTTTAGCGAGGATCGGTTTGGGGCCATCAACAAGAAGCAGTGGCTC
CTGGGAAACAGCATCATCACCATCAAGCAGGCCGCGGCGTCGGGGTGGGCTCAGATCATCAAGAGACAGCCGTCG
GGAACTTCGGCTTATACGGTGAGGGAGTCTCTGAGGCCGCCGCCTCCTCACCAGACGGAGGCCCATGTCGATGTC
AGCCGCGAGGGCCGGCCGACTTCTAACGCTGTGCTGCCGAGCCACTTACTGGTTCAGCTGATGGCCCCGGTGCCG
CAGACGTTCGAGTCGGCTCGACCGATCCCGTTGCCGCAAGACGAGGCAGTAGAGCGCGCAATCCGGGTCTTTGAC
AGGAACTCGAGCCTCGACGGACACAAGGTGGGCGTCATCTACATTGGTGAGGGCCAGACCAGGGAGGCCGACATT
CTGGCCAACGTCATCGGGAGCAGAGATTACCTCGCCTTCCTCAACACTCTGGGGACCCTGACGAAGCTCAAGGGA
GCCACGTTCAACACCCAAGGCCTGGATCGCGAGTACGACTCGGACGGCGAGTATACCTTTTGCTGGAGAGACAGA
GTGACGGAGATTGTCTTTCACGTGACGACGCAGATGCCGACGGACTTGGAGCGGGATGCTCAATGCACGATGAAG
AAGAGGCATATTGGCAACGACTTTGTCAGCATCATCTTCAACGACTCGGGTCTTCCTTTCCGCTTCGACACGTTC
CCCAGCCAGTTCAACTTTGTCAACATCGTCATCACGCCGGCTTCCCGAGCTTCCTTTATAGCGATGCGTGAGGCG
GAGGCGAGTCTGGGGCGGAGGCAGCCCTTTTACAGGGTGCAGGTCATGAGCAAACCCGGCTTTCCCGAAGTGTCG
CCCGCGTCGGAGACGAAGATGATATCACTCAAGGCCCTTGCCGGCTTCGTCCGGCTCCTCGCCCTCAACGCCTCT
ATGTTCTCGGTGGTGTGGCACAACCAGGAAGGAGGCGAACACATCAGCTCGTGGAGCGCCAGGCTGCGAGAGATT
AAGCGGCTGCGGGATAGATACGGGCCCAAAGCGGCGGCGGCGGCGGCGACGACGACGACGACGGCCTCGTCTCCT
CCGGGCACGGCGCTGTCTGGCGGTCAACAGCCGGAGGCAGCGCGGGCCGGCACCAGCGTGAGGGACAGCCTCAGC
AGCCTGAGGAGGACGAGCGTGGCGACGTTTTTTACGAGTGCGAGCGAGCAGGCGTCGCATCGGTCGTCGACGCTC
TCGACATCGGCAGCATCGAATGATACGGAGCTGCCGGTGGCGGCGAACCCGTTGGTCGAGTCGGTTGACTTTTCC
AAGTGGGCTCGTTGA
Transcript >Ophcf2|04891
ATGCCCACCCCAAAGCAAGCAGCTCGCTTTCACCTCTCGAGCCCATGTTGTCCTGAGGAGCTCTCTCTTCCTCCG
AGGCTATCCTCGGCTGTCAAAATCAAAGCATCCTCAGCCGAGCACATGTCCCCGCAGCCCGAAGATGATACTTCG
TCGCCCAGCTCGGCACGCCAAGGAGGCTTTGGCAACGTTTTCCGCACTCTGACCATTTCCAGAGGTGACAGGACG
CTGCACAATCTTCCCTCGGCCGCCCCCCAACCGAGGACAGAGATCGTCCATGCCGGTTCTTCGAGCTCTCGCGAG
CTGTCGACCAACCACAGGGATGCCTTGGAGCTCCTCAGGAGCGATGTGCCCAGCGACCGAATCTCCGCCGCTAGC
ACCCTCAAGTACGCCATCGCCGAGTATCCTGTGAACCCTGTCCTCGACATTTGGTACGCCGCCAAAGATATGATT
GAGCCCGCCAACCCGGTTACCATGCGTACGGCGGGCTGGGAGCTTTTGACCGAGTGTGCCAAGCATCCATCTTCT
ACAGATCTTGAGCGAAGGGAGTATTTCCAAACCCTGTCTGCGACCGCTAGCCAGGAAGACTTTCATCTGCAGCTT
GCTGCCCTTGTCGATCTCAGCAAAGGTGGCCGCGCCGTATCGGGCTTTGGCTACGATCTCGTTCCGCTTTTGACG
GGTTGGCTGCAAGGGGCCTACAAGACGGCTCGCAAGGCTCGTAGGAACGCCCAGTCGACTCGAGGTCAAAGAAGC
TCGTCTAGGGGCAGAGCAGCGGCATCTGGCGAAGAGAAGAATCTAACGCAGCTCTTCCAGTTCTTCCACGATGTC
ATCAAATTCAGCTTCAACAATGCAAACGAAGCATCCGTCACGGAGCTTCTCGATAGCCTCCTCGTCATATGCATG
AACACAAGCGTGGAAGACGACCTCCAGTCCTGCATCAGTATACTCGACGCCATCGTGACCTTTGGGGCGATTCCT
CCCCACAAGCTCAAGGACTGCGTTCAGGTTCTTGCCTCTATTTTCTGCATGGTGCCCGCTTTGCAGAAGAAGTCG
TGGCACAACATTGCAAACCTTTGCAAGTCTCACAATGGCCAAGCTGTCGTACGCGTCATGCTGGACATTCTCCGT
AACCGTCCCGCCGACGGACTCGGTGACAAGGATACGAGCAGAGAAGTTAAAGGCTCCATTGCGGTGCTGCAGAAA
CTGCTGTCAAAGTCGGCTGAAAAGGGGTATCCGACCGTGCCGTTTGCGCCGCTCGTTGACGGTCTATCCAACACG
CTGAGGGCATCATCGTCCCCTCGAGTCTACGCTGCCCTTCTCCAGCTGATCAACTTTCTGTTTGACGACGGGGGC
GGCAAGACTCACCGCGTCATCGTGGACGAGGACTGGTCAGGGTGTCTCGACGTAGCGGCCGAATGCGGGAAAAGG
ATGAATGGCGATGCAGACAGGAGACGAGGCAGCAGTCCTGCCAAGGAAGAGGCCCCGGAGGCGGTGGTCGACCGC
GAGCTCATGAAGCTCATCCGCAGGCTCGACGACATTGTCAAAGACAAGTCGGGCGACTTTGTGCCACGAGAGACC
ATCATCAGGTTCTTCGCGGACGTCAACTTTCTCCTGCCGGACGCGACGGTGAGAACGGTATTGGACTACTTTCAA
GAGTTTCGATGCTGTTCGCCTTCCGACCTCCGATGGGAAGAGAATCTGTCGTTGGTTTTGGAGGCCTTCTTCAGC
AACCCGAGGCTGAGCTCGACCACGCGGCTACGGGCGTTGCAGACCACCATGGACGCGTACGAAATCGTCGATCTC
GTCGGCGACGGTGCGGAGCAGAACCTGATTCCCCGCCTGGCCGAGAGCGTCCTCAGGAACGTATCGCAAGAGACC
GACTTGTCCGTGCTGGAGGCCGTCATGTCGCTCATGACGTCCGTCATCGAGTCCTGCGACATGGAGTTGTTCAGC
TACGTGATTGACAGGCTCAAGGAAATCGTCCTCAACGACCGAACCAGGTCGCCCATGTCGTCCCCGTCAACTCCT
GCAGTTCAGTCCCCTTCGGCATCTGGCGCGGTCCCCGCTGCCGCAGACCAGTCGTCGTCCAGCGTGGTGACGCGC
TGCTTCGTCAAGATGTTCCTTCGGGTCGTCAACTCACACGGGGAGAAGAGCGTGCGACTGTTCAACGCGCTTGTG
GCCGTCGCTAGGACGAGCCACTGCGAGGTCGACGCTCGGCTAGAGGCGATGAAGCTACTGTTTCGATTACGCGCC
GACTGGGCTAATCGTGTCTTTGTTACCGATGATGTCGAGAACAGCTTCCTGGCCAACGCCATGTGTCGAACAGAG
GCTTCCATCGTTAGGAAGCAGGCTGAGGAGACGGCACAATCCTTCAGGCTGTCCAAGAGCGAGCACGTGGCTCAG
TCCCGTCCTTCACGCGGCATATCATTCGGTCAGGGGCCGGCGCACGAGAGGGCTCTCCCGGTTCGCACGCCGAGC
GGTGTCAAGAGCGTGCAGCAAAGGTATTGCCAGATGTGGAGTTATCCCGATGCTGCCGCTCTTCCAGACGCGATG
CCCAAGCTCATCAGCCCCATCTTGGTCTCCCGCGCATCGCCCGTTGCCGACGATGGCCTCTGTCCCAGTGGCGAA
GTCAGGGCTCCGCAGAACTCTGCGCTCAACATGTCGGCGTGGCTCAGCGCCGTCTTGGTCGTTCTTCAGGGAAGC
GACTGGGAGGTGTACAGCTTCGCACTGGTTCATCTGCCGTCGCAGCTCAGCAACCATGCCATCTTTAGGGATGCG
ATCCCACAGATCCAAGAGCTCCGGAGGATCATCTGCGAGCAGATCCGGACAAACGGCTTCCAGGAGCCGCCGTTT
GTCACGGGACTTCGCCGCGCCGACGTGGCAATCTGTCTGTTCCACAGCTTGACCATGATCCTAAGCTATCACGAG
CATTTCACCAAGAGCGAAGAGGACGACATCGTCAAGACGTTTGCCTACGGTATCGCTGCTTGGGAGCGGACGGCC
AAGTACTGCATCCACGCCCTGTCCATCTGCTGCCACGAGCTGCCGCTATCGACGAGCAAGTGCCTGATCCAGGTG
CTGAACCAGATGGCGGCCATCATCACGCAGCCCCACGTCTCGGTTCATATCCTCGAGTTTCTGGCCTCGCTGAGC
CGCCTTCACGACGTCTTTGTCAACTTCCGGGAGGAAGACTATCGCATCGTGTTTGGCATCTGCTTCCGCTACCTC
GAGTACGCCAGAGAGAAGCGGCAGTCGAACCGCAGCAGCCATGTAAGCGAAGCCTCTGCGCCCGTGACGCCGGGT
TCGACTGCTGCCGATGGGACCGCTTCGGATGAACTTCCGCAATACGTGCACGCTATGGCCTATCACGTCATACTG
TTTTGGTTTCTTGCGCTGAAGCTCCAGGATCGAGCCCACCACGTGGGGTGGATCGTCAGGAAGCTCTTCGCCGAC
GGCGACGGCTACGGACAAGCGGCCGACGACCAGGCGCTGACGTCGATTGACTTCATGCAGAGAGTCGCCTTCGCC
GACGTTGGCGAGTCGGCCGAGGACCCCTACTTTAGCGAGGATCGGTTTGGGGCCATCAACAAGAAGCAGTGGCTC
CTGGGAAACAGCATCATCACCATCAAGCAGGCCGCGGCGTCGGGGTGGGCTCAGATCATCAAGAGACAGCCGTCG
GGAACTTCGGCTTATACGGTGAGGGAGTCTCTGAGGCCGCCGCCTCCTCACCAGACGGAGGCCCATGTCGATGTC
AGCCGCGAGGGCCGGCCGACTTCTAACGCTGTGCTGCCGAGCCACTTACTGGTTCAGCTGATGGCCCCGGTGCCG
CAGACGTTCGAGTCGGCTCGACCGATCCCGTTGCCGCAAGACGAGGCAGTAGAGCGCGCAATCCGGGTCTTTGAC
AGGAACTCGAGCCTCGACGGACACAAGGTGGGCGTCATCTACATTGGTGAGGGCCAGACCAGGGAGGCCGACATT
CTGGCCAACGTCATCGGGAGCAGAGATTACCTCGCCTTCCTCAACACTCTGGGGACCCTGACGAAGCTCAAGGGA
GCCACGTTCAACACCCAAGGCCTGGATCGCGAGTACGACTCGGACGGCGAGTATACCTTTTGCTGGAGAGACAGA
GTGACGGAGATTGTCTTTCACGTGACGACGCAGATGCCGACGGACTTGGAGCGGGATGCTCAATGCACGATGAAG
AAGAGGCATATTGGCAACGACTTTGTCAGCATCATCTTCAACGACTCGGGTCTTCCTTTCCGCTTCGACACGTTC
CCCAGCCAGTTCAACTTTGTCAACATCGTCATCACGCCGGCTTCCCGAGCTTCCTTTATAGCGATGCGTGAGGCG
GAGGCGAGTCTGGGGCGGAGGCAGCCCTTTTACAGGGTGCAGGTCATGAGCAAACCCGGCTTTCCCGAAGTGTCG
CCCGCGTCGGAGACGAAGATGATATCACTCAAGGCCCTTGCCGGCTTCGTCCGGCTCCTCGCCCTCAACGCCTCT
ATGTTCTCGGTGGTGTGGCACAACCAGGAAGGAGGCGAACACATCAGCTCGTGGAGCGCCAGGCTGCGAGAGATT
AAGCGGCTGCGGGATAGATACGGGCCCAAAGCGGCGGCGGCGGCGGCGACGACGACGACGACGGCCTCGTCTCCT
CCGGGCACGGCGCTGTCTGGCGGTCAACAGCCGGAGGCAGCGCGGGCCGGCACCAGCGTGAGGGACAGCCTCAGC
AGCCTGAGGAGGACGAGCGTGGCGACGTTTTTTACGAGTGCGAGCGAGCAGGCGTCGCATCGGTCGTCGACGCTC
TCGACATCGGCAGCATCGAATGATACGGAGCTGCCGGTGGCGGCGAACCCGTTGGTCGAGTCGGTTGACTTTTCC
AAGTGGGCTCGTTGA
Gene >Ophcf2|04891
ATGCCCACCCCAAAGCAAGCAGGTCTCCAAGACAGCTAGTTTTGACGCAAGCCTCGAGCATCCTACCTGCGGGTT
AACCTGGCCTTGAGCTCGCTTTCACCTCTCGAGCCCATGTTGTCCTGAGGAGCTCTCTCTTCCTCCGGTAAAACT
CGTCACAACCTCACTTATCCCCTTCCTGGCCCTTCCATACACCTCCCTCGATTCTATCACACCCCCTAATCAGCC
CTTACATACCTCCAACTGACTTTATCCTTGACAGAGGCTATCCTCGGCTGTCAAAATCAAAGCATCCTCAGCCGA
GCACATGTCCCCGCAGCCCGAAGATGATACTTCGTCGCCCAGCTCGGCACGCCAAGGAGGCTTTGGCAACGTTTT
CCGCACTCTGACCATTTCCAGAGGTGACAGGACGCTGCACAATCTTCCCTCGGCCGCCCCCCAACCGAGGACAGA
GATCGTCCATGCCGGTTCTTCGAGCTCTCGCGAGCTGTCGACCAACCACAGGGATGCCTTGGAGCTCCTCAGGAG
CGATGTGCCCAGCGACCGAATCTCCGCCGCTAGCACCCTCAAGTACGCCATCGCCGAGTATCCTGTGAACCCTGT
CCTCGACATTTGGTACGCCGCCAAAGATATGATTGAGCCCGCCAACCCGGTTACCATGCGTACGGCGGGCTGGGA
GCTTTTGACCGAGTGTGCCAAGCATCCATCTTCTACAGATCTTGAGCGAAGGGAGTATTTCCAAACCCTGTCTGC
GACCGCTAGCCAGGAAGACTTTCATCTGCAGCTTGCTGCCCTTGTCGATCTCAGCAAAGGTGGCCGCGCCGTATC
GGGCTTTGGCTACGATCTCGTTCCGCTTTTGACGGGTTGGCTGCAAGGGGCCTACAAGACGGCTCGCAAGGCTCG
TAGGAACGCCCAGTCGACTCGAGGTCAAAGAAGCTCGTCTAGGGGCAGAGCAGCGGCATCTGGCGAAGAGAAGAA
TCTAACGCAGCTCTTCCAGTTCTTCCACGATGTCATCAAATTCAGCTTCAACAATGCAAACGAAGCATCCGTCAC
GGAGCTTCTCGATAGCCTCCTCGTCATATGCATGAACACAAGCGTGGAAGACGACCTCCAGTCCTGCATCAGTAT
ACTCGACGCCATCGTGACCTTTGGGGCGATTCCTCCCCACAAGCTCAAGGACTGCGTTCAGGTTCTTGCCTCTAT
TTTCTGCATGGTGCCCGCTTTGCAGAAGAAGTCGTGGCACAACATTGCAAACCTTTGCAAGTCTCACAATGGCCA
AGCTGTCGTACGCGTCATGCTGGACATTCTCCGTAACCGTCCCGCCGACGGACTCGGTGACAAGGATACGAGCAG
AGAAGTTAAAGGCTCCATTGCGGTGCTGCAGAAACTGCTGTCAAAGTCGGCTGAAAAGGGGTATCCGACCGTGCC
GTTTGCGCCGCTCGTTGACGGTCTATCCAACACGCTGAGGGCATCATCGTCCCCTCGAGTCTACGCTGCCCTTCT
CCAGCTGATCAACTTTCTGTTTGACGACGGGGGCGGCAAGACTCACCGCGTCATCGTGGACGAGGACTGGTCAGG
GTGTCTCGACGTAGCGGCCGAATGCGGGAAAAGGATGAATGGCGATGCAGACAGGAGACGAGGCAGCAGTCCTGC
CAAGGAAGAGGCCCCGGAGGCGGTGGTCGACCGCGAGCTCATGAAGCTCATCCGCAGGCTCGACGACATTGTCAA
AGACAAGTCGGGCGACTTTGTGCCACGAGAGACCATCATCAGGTTCTTCGCGGACGTCAACTTTCTCCTGCCGGA
CGCGACGGTGAGAACGGTATTGGACTACTTTCAAGAGTTTCGATGCTGTTCGCCTTCCGACCTCCGATGGGAAGA
GAATCTGTCGTTGGTTTTGGAGGCCTTCTTCAGCAACCCGAGGCTGAGCTCGACCACGCGGCTACGGGCGTTGCA
GACCACCATGGACGCGTACGAAATCGTCGATCTCGTCGGCGACGGTGCGGAGCAGAACCTGATTCCCCGCCTGGC
CGAGAGCGTCCTCAGGAACGTATCGCAAGAGACCGACTTGTCCGTGCTGGAGGCCGTCATGTCGCTCATGACGTC
CGTCATCGAGTCCTGCGACATGGAGTTGTTCAGCTACGTGATTGACAGGCTCAAGGAAATCGTCCTCAACGACCG
AACCAGGTCGCCCATGTCGTCCCCGTCAACTCCTGCAGTTCAGTCCCCTTCGGCATCTGGCGCGGTCCCCGCTGC
CGCAGACCAGTCGTCGTCCAGCGTGGTGACGCGCTGCTTCGTCAAGATGTTCCTTCGGGTCGTCAACTCACACGG
GGAGAAGAGCGTGCGACTGTTCAACGCGCTTGTGGCCGTCGCTAGGACGAGCCACTGCGAGGTCGACGCTCGGCT
AGAGGCGATGAAGCTACTGTTTCGATTACGCGCCGACTGGGCTAATCGTGTCTTTGTTACCGATGATGTCGAGAA
CAGCTTCCTGGCCAACGCCATGTGTCGAACAGAGGCTTCCATCGTTAGGAAGCAGGCTGAGGAGACGGCACAATC
CTTCAGGCTGTCCAAGAGCGAGCACGTGGCTCAGTCCCGTCCTTCACGCGGCATATCATTCGGTCAGGGGCCGGC
GCACGAGAGGGCTCTCCCGGTTCGCACGCCGAGCGGTGTCAAGAGCGTGCAGCAAAGGTATTGCCAGATGTGGAG
TTATCCCGATGCTGCCGCTCTTCCAGACGCGATGCCCAAGCTCATCAGCCCCATCTTGGTCTCCCGCGCATCGCC
CGTTGCCGACGATGGCCTCTGTCCCAGTGGCGAAGTCAGGGCTCCGCAGAACTCTGCGCTCAACATGTCGGCGTG
GCTCAGCGCCGTCTTGGTCGTTCTTCAGGGAAGCGACTGGGAGGTGTACAGCTTCGCACTGGTTCATCTGCCGTC
GCAGCTCAGCAACCATGCCATCTTTAGGGATGCGATCCCACAGATCCAAGAGCTCCGGAGGATCATCTGCGAGCA
GATCCGGACAAACGGCTTCCAGGAGCCGCCGTTTGTCACGGGACTTCGCCGCGCCGACGTGGCAATCTGTCTGTT
CCACAGCTTGACCATGATCCTAAGCTATCACGAGCATTTCACCAAGAGCGAAGAGGACGACATCGTCAAGACGTT
TGCCTACGGTATCGCTGCTTGGGAGCGGACGGCCAAGTACTGCATCCACGCCCTGTCCATCTGCTGCCACGAGCT
GCCGCTATCGACGAGCAAGTGCCTGATCCAGGTGCTGAACCAGATGGCGGCCATCATCACGCAGCCCCACGTCTC
GGTTCATATCCTCGAGTTTCTGGCCTCGCTGAGCCGCCTTCACGACGTCTTTGTCAACTTCCGGGAGGAAGACTA
TCGCATCGTGTTTGGCATCTGCTTCCGCTACCTCGAGTACGCCAGAGAGAAGCGGCAGTCGAACCGCAGCAGCCA
TGTAAGCGAAGCCTCTGCGCCCGTGACGCCGGGTTCGACTGCTGCCGATGGGACCGCTTCGGATGAACTTCCGCA
ATACGTGCACGCTATGGCCTATCACGTCATACTGTTTTGGTTTCTTGCGCTGAAGCTCCAGGATCGAGCCCACCA
CGTGGGGTGGATCGTCAGGAAGCTCTTCGCCGACGGCGACGGCTACGGACAAGCGGCCGACGACCAGGCGCTGAC
GTCGATTGACTTCATGCAGAGAGTCGCCTTCGCCGACGTTGGCGAGTCGGCCGAGGACCCCTACTTTAGCGAGGA
TCGGTTTGGGGCCATCAACAAGAAGCAGTGGCTCCTGGGAAACAGCATCATCACCATCAAGCAGGCCGCGGCGTC
GGGGTGGGCTCAGATCATCAAGAGACAGCCGTCGGGAACTTCGGCTTATACGGTGAGGGAGTCTCTGAGGCCGCC
GCCTCCTCACCAGACGGAGGCCCATGTCGATGTCAGCCGCGAGGGCCGGCCGACTTCTAACGCTGTGCTGCCGAG
CCACTTACTGGTTCAGCTGATGGCCCCGGTGCCGCAGACGTTCGAGTCGGCTCGACCGATCCCGTTGCCGCAAGA
CGAGGCAGTAGAGCGCGCAATCCGGGTCTTTGACAGGAACTCGAGCCTCGACGGACACAAGGTGGGCGTCATCTA
CATTGGTGAGGGCCAGACCAGGGAGGCCGACATTCTGGCCAACGTCATCGGGAGCAGAGATTACCTCGCCTTCCT
CAACACTCTGGGGACCCTGACGAAGCTCAAGGGAGCCACGTTCAACACCCAAGGCCTGGATCGCGAGTACGACTC
GGACGGCGAGTATACCTTTTGCTGGAGAGACAGAGTGACGGAGATTGTCTTTCACGTGACGACGCAGATGCCGAC
GGACTTGGAGCGGGATGCTCAATGCACGATGAAGAAGAGGCATATTGGCAACGACTTTGTCAGCATCATCTTCAA
CGACTCGGGTCTTCCTTTCCGCTTCGACACGTTCCCCAGCCAGTTCAACTTTGTCAACATCGTCATCACGCCGGC
TTCCCGAGCTTCCTTTATAGCGATGCGTGAGGCGGAGGCGAGTCTGGGGCGGAGGCAGCCCTTTTACAGGGTGCA
GGTCATGAGCAAACCCGGCTTTCCCGAAGTGTCGCCCGCGTCGGAGACGAAGATGATATCACTCAAGGCCCTTGC
CGGCTTCGTCCGGCTCCTCGCCCTCAACGCCTCTATGTTCTCGGTGGTGTGGCACAACCAGGAAGGAGGCGAACA
CATCAGCTCGTGGAGCGCCAGGCTGCGAGAGATTAAGCGGCTGCGGGATAGATACGGGCCCAAAGCGGCGGCGGC
GGCGGCGACGACGACGACGACGGCCTCGTCTCCTCCGGGCACGGCGCTGTCTGGCGGTCAACAGCCGGAGGCAGC
GCGGGCCGGCACCAGCGTGAGGGACAGCCTCAGCAGCCTGAGGAGGACGAGCGTGGCGACGTTTTTTACGAGTGC
GAGCGAGCAGGCGTCGCATCGGTCGTCGACGCTCTCGACATCGGCAGCATCGAATGATACGGAGCTGCCGGTGGC
GGCGAACCCGTTGGTCGAGTCGGTTGACTTTTCCAAGTGGGCTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail