Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04884
Gene name
Locationscaffold_05:1868073..1869211
Strand+
Gene length (bp)1138
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 65 87 22
3 114 136 22
4 148 170 22
5 238 260 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.12 0.00 0.43
Alive In ants, during behavior modification 0.93 0.00 2.03
Dead In ants, recently dead 6.84 1.78 11.91

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.086550 no
Alive Dead 0.000238 yes
Dead Fungus 0.076128 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04884
MEDATVLVPIMAPPPGVTSNFTDPVTNGLILTRLIPVFMAVVVFFAVLRVYTRAFVTRSLGFDDVLAVFSAALIV
ADLAVNFYLLHNVSSEGIFGVHLYDVPITRVTGSLMQSIMWLLLLYIVASMSIKLTILTLYHRLFPLVRHVTWMI
RIGFALIIASYAAFFIGVLVMCVPSIPRADSFHDRRLSPEAIGLLQCISKCSAIGKVLSVFNPVSDIYLMSIPLP
LIKDLRTSRGKKAGAFAIFLTGILACAVSIVGAVFRVSQGLDFGWEIIRTTMVL*
Coding >Ophcf2|04884
ATGGAAGACGCCACGGTACTCGTACCCATCATGGCGCCGCCCCCGGGCGTGACGTCCAACTTTACAGATCCGGTT
ACGAACGGTCTGATTCTGACGAGGTTGATACCGGTCTTTATGGCTGTTGTCGTCTTTTTCGCCGTCTTGAGAGTC
TACACTCGCGCGTTTGTGACTCGTTCTCTAGGCTTTGACGATGTTCTTGCCGTGTTCAGCGCGGCCTTGATTGTC
GCCGACTTGGCTGTCAACTTCTACCTGCTTCACAATGTATCAAGTGAAGGCATATTTGGCGTTCACCTCTACGAT
GTCCCCATCACCAGAGTCACAGGCTCTCTCATGCAGTCCATCATGTGGCTGCTCCTCCTCTACATAGTAGCCTCC
ATGAGCATCAAACTAACCATCCTAACCCTCTACCATCGACTCTTCCCGCTCGTCCGCCACGTCACCTGGATGATC
AGGATCGGATTCGCCCTCATAATAGCTTCCTACGCCGCTTTCTTCATCGGCGTTCTGGTCATGTGCGTGCCAAGC
ATACCACGAGCAGACAGCTTTCACGACAGACGGCTATCTCCGGAAGCCATCGGTCTCCTGCAATGCATCTCCAAA
TGCAGCGCCATCGGCAAGGTTCTCTCCGTCTTCAACCCCGTATCGGACATCTACCTCATGTCTATCCCTCTGCCA
CTGATCAAGGATCTGAGGACATCTCGCGGGAAGAAAGCCGGCGCCTTCGCCATCTTCCTCACCGGCATCCTAGCC
TGCGCCGTTTCCATCGTGGGCGCTGTTTTCCGCGTTTCCCAGGGCCTCGATTTTGGCTGGGAGATTATCCGAACT
ACCATGGTCTTGTAA
Transcript >Ophcf2|04884
ATGGAAGACGCCACGGTACTCGTACCCATCATGGCGCCGCCCCCGGGCGTGACGTCCAACTTTACAGATCCGGTT
ACGAACGGTCTGATTCTGACGAGGTTGATACCGGTCTTTATGGCTGTTGTCGTCTTTTTCGCCGTCTTGAGAGTC
TACACTCGCGCGTTTGTGACTCGTTCTCTAGGCTTTGACGATGTTCTTGCCGTGTTCAGCGCGGCCTTGATTGTC
GCCGACTTGGCTGTCAACTTCTACCTGCTTCACAATGTATCAAGTGAAGGCATATTTGGCGTTCACCTCTACGAT
GTCCCCATCACCAGAGTCACAGGCTCTCTCATGCAGTCCATCATGTGGCTGCTCCTCCTCTACATAGTAGCCTCC
ATGAGCATCAAACTAACCATCCTAACCCTCTACCATCGACTCTTCCCGCTCGTCCGCCACGTCACCTGGATGATC
AGGATCGGATTCGCCCTCATAATAGCTTCCTACGCCGCTTTCTTCATCGGCGTTCTGGTCATGTGCGTGCCAAGC
ATACCACGAGCAGACAGCTTTCACGACAGACGGCTATCTCCGGAAGCCATCGGTCTCCTGCAATGCATCTCCAAA
TGCAGCGCCATCGGCAAGGTTCTCTCCGTCTTCAACCCCGTATCGGACATCTACCTCATGTCTATCCCTCTGCCA
CTGATCAAGGATCTGAGGACATCTCGCGGGAAGAAAGCCGGCGCCTTCGCCATCTTCCTCACCGGCATCCTAGCC
TGCGCCGTTTCCATCGTGGGCGCTGTTTTCCGCGTTTCCCAGGGCCTCGATTTTGGCTGGGAGATTATCCGAACT
ACCATGGTCTTGTAA
Gene >Ophcf2|04884
ATGGAAGACGCCACGGTACTCGTACCCATCATGGCGCCGCCCCCGGGCGTGACGTCCAACTTTACAGATCCGGTT
ACGAACGGTCTGATTCTGACGAGGTTGATACCGGTCTTTATGGCTGTTGTCGTCTTTTTCGCCGTCTTGAGAGTC
TACACTCGCGCGTTTGTGACTCGTTCTCTAGGCTTTGACGATGGTAAGCTGCGTGGGAATGAAGATCAAGGATGC
CATCTGATTGCTCGTACATTTAGTTCTTGCCGTGTTCAGCGCGGTGAGTTCCACATCACATTGATGTCTGGCGAG
ACGTACACTCATGTTTCTTGTTGTAGGCCTTGATTGTCGCCGACTTGGCTGTCAACTTCTACCGTACGTTGCTGC
AACGATGAGATTTCCCACGACACCTTCGCTGGCTTTACTGACTAGCAACGACTGAAGTGCTTCACAATGTATCAA
GTGAAGGCATATTTGGCGTTCACCTCTACGATGTCCCCATCACCAGAGTCACAGGCTCTCTCATGCAGGTTCGCT
CCATCTCAACCCCCCATCTCAACCCCAAACATCAGATACAGCTGGCTCATCAACTCCAGTCCATCATGTGGCTGC
TCCTCCTCTACATAGTAGCCTCCATGAGCATCAAACTAACCATCCTAACCCTCTACCATCGACTCTTCCCGCTCG
TCCGCCACGTCACCTGGATGATCAGGATCGGATTCGCCCTCATAATAGCTTCCTACGCCGCTTTCTTCATCGGCG
TTCTGGTCATGTGCGTGCCAAGCATACCACGAGCAGACAGCTTTCACGACAGACGGCTATCTCCGGAAGCCATCG
GTCTCCTGCAATGCATCTCCAAATGCAGCGCCATCGGCAAGGTTCTCTCCGTCTTCAACCCCGTATCGGACATCT
ACCTCATGTCTATCCCTCTGCCACTGATCAAGGATCTGAGGACATCTCGCGGGAAGAAAGCCGGCGCCTTCGCCA
TCTTCCTCACCGGCATCCTGTACGTCTTTCTCACGTAGATTCGCTCACGTAACTGATAGAATCATCCAGAGCCTG
CGCCGTTTCCATCGTGGGCGCTGTTTTCCGCGTTTCCCAGGGCCTCGATTTTGGCTGGGAGATTATCCGAACTAC
CATGGTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail