Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04856
Gene name
Locationscaffold_05:1791280..1794920
Strand+
Gene length (bp)3640
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08514 STAG STAG domain 6.8E-35 195 302

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1714 0.9427 0.1025 0.0161 0.0728 0.0304 0.0303 0.0228 0.0453 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3633
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5177
Ophiocordyceps australis map64 (Brazil) OphauB2|5827
Ophiocordyceps camponoti-floridani Ophcf2|04856 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6344
Ophiocordyceps kimflemingae Ophio5|5504
Ophiocordyceps subramaniannii Hirsu2|7016

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04856
MDGSPSASSETETMTTRRRSGRVVRPPAKFAFKRKRDDNDADAADDDEVDDDAGSGSESSDEPDAASDADHQPPR
WRKPSRSKKPSNKKPKINGSGHVTRIPSRPKKVVRIDAGEHGSGLFADIFGSGDAPDAIAKAWLDKYRHDDAEAM
ADLVNCILQCAGCDLQVTTDDIRDPENIPNRLVDLQSIHQEQQITDYPLIAKAKSTRSFRELLVSFLQQLMTLLH
ETDVLYKDADLINNLHAWLSSMSSSSLRPFRHTATTIALAVQSGLIEVAGVLDRRIATIEQQSQAAKKGKNKSKA
AEIQRGLTEANGYRKMCSESIQSFFDTVFVHRYRDVDAKIRTECVEALGSWIWNLPTVFMEPGYLRYLGWMLSDT
YAATRHEVLKQLLRVFKRDAQQLGHFIDRFRPRLVEMATLDSEVSVRVAAISVIDALRAAALLEPNEIDAIGKLI
FDTELRIRKAVVGFFVACIDDVHQGKLDEIGGAEALEELDDGDQDDFESPRKEWVNIKCLAESLAIYDAQIEEAQ
QHGGLAPDLDAAADLLDAAVPDTRISLAAQVLYEKLSEVKSWELLAGYLLFDHTTSKSARSRTAGNSAFRKAVAP
TSQEESILLDVLSSAIRLSLAQAGEHDRSKKRSHHRNEAAEAHEDTALELTTVIPKLLSKFGAEPETAAIVLRLE
HFLNLDSFQQLRQDASKYEKLLDEISTQFIRHDDKRVLFEATSALLHARQCQELEELTDGKLSMLWDNVINALRK
FDETCELSVRGNLAAAPLRELSTTLVKISKLASISDCVDALEATSRSGESQGPAIEMLTNVVHRGKYEPQEDDID
DVEDEVVSSAIKACQFYFMWKTRALAQLLAAGTSISEAELDSLSALRQSYRRHLIETFSSRAAIDQLRLFATGSL
CDLHLTLATLRRPLRDSSDPGRGEKLRVLLQNIEPGLVPELTSIFDGAEKMYAKKAKKDKTLNEPAEDEDPVADD
EDLDDEDGEDDGDDEGQSREERYAAELRAEKALCELTAKYVLAMRAGLIEERGPQPGKLRRRVLRNRLKLGNNFK
EVVAYLDEKQQPAKQQAAKKPASTTAAKQQQQTAKHKSIADEEEGVFEDVEPEEGSREDLRRRELLDEEPPVEDE
SDGGAVGSWPMTTSLVIEMGEGMGMASSCSSECTCLGVYEGEASF*
Coding >Ophcf2|04856
ATGGACGGCAGCCCCAGCGCGAGTTCGGAGACGGAGACTATGACGACGCGTCGCCGATCTGGACGCGTCGTGCGG
CCCCCGGCCAAGTTCGCGTTCAAGCGGAAGAGAGACGACAATGACGCCGATGCCGCCGACGACGATGAGGTTGAC
GACGATGCCGGCTCCGGCTCCGAATCGAGCGACGAGCCTGATGCCGCCAGCGATGCCGACCACCAGCCGCCTAGA
TGGCGCAAGCCGTCGCGCAGCAAGAAGCCCTCGAACAAGAAGCCCAAAATCAACGGCTCGGGACATGTCACTCGC
ATCCCCTCGAGACCGAAGAAAGTGGTTCGAATCGATGCCGGCGAGCATGGTTCCGGTCTCTTTGCCGACATCTTT
GGTTCCGGTGACGCCCCGGACGCCATTGCCAAGGCCTGGCTGGACAAGTATAGGCATGACGACGCGGAGGCCATG
GCTGACTTGGTCAACTGCATCCTTCAATGCGCTGGTTGCGACCTGCAAGTCACGACGGACGACATTCGCGATCCT
GAAAATATCCCGAATCGACTGGTTGATCTTCAGAGCATCCACCAAGAGCAACAAATCACAGATTACCCCTTGATA
GCCAAGGCCAAGAGCACGAGATCCTTTCGCGAGCTGCTCGTCTCCTTTCTCCAACAACTGATGACGCTCCTTCAC
GAGACCGACGTGCTTTACAAAGACGCCGACTTGATCAACAACTTGCACGCATGGCTCTCTAGCATGTCGTCTTCA
TCCCTCCGGCCTTTCCGTCACACAGCGACGACAATAGCCCTCGCCGTGCAGTCGGGCCTCATCGAAGTGGCTGGC
GTGCTCGATCGGCGGATCGCTACCATCGAGCAGCAGTCCCAGGCAGCGAAGAAGGGCAAGAACAAGTCCAAGGCC
GCCGAGATCCAGCGCGGCCTGACAGAGGCCAACGGGTACCGCAAGATGTGCAGCGAGTCGATCCAGTCCTTCTTC
GATACCGTCTTCGTTCACCGTTACCGCGACGTCGACGCCAAGATTCGCACCGAGTGCGTCGAAGCCCTGGGGTCC
TGGATCTGGAACCTACCCACCGTCTTCATGGAGCCGGGTTACCTGCGCTATCTCGGCTGGATGCTCTCGGACACG
TACGCGGCCACACGGCACGAGGTGCTCAAGCAGCTCTTGCGCGTCTTCAAACGTGACGCTCAGCAGCTCGGCCAC
TTCATCGACCGCTTTCGGCCGAGGCTGGTCGAGATGGCCACGCTCGACTCCGAGGTCTCTGTGAGAGTGGCGGCC
ATCTCGGTTATCGACGCGTTACGCGCCGCCGCCCTGCTAGAGCCCAACGAGATTGACGCCATCGGGAAGCTGATA
TTCGATACGGAGCTGCGGATCCGCAAGGCCGTCGTCGGCTTCTTCGTCGCCTGCATCGATGACGTCCATCAGGGC
AAGCTGGATGAGATTGGCGGCGCCGAGGCGCTGGAGGAGCTCGACGATGGCGACCAGGATGACTTTGAGTCGCCG
CGCAAAGAATGGGTCAACATCAAATGCCTGGCCGAGTCTCTCGCCATTTACGACGCCCAGATCGAAGAGGCTCAG
CAGCACGGCGGCCTGGCACCGGACCTGGACGCGGCCGCCGATCTGCTGGACGCGGCCGTGCCTGACACGAGAATA
TCTCTCGCGGCTCAGGTTCTGTACGAGAAGCTGTCCGAGGTCAAGTCGTGGGAGCTGCTCGCGGGATATCTGCTT
TTCGACCACACGACGAGCAAGTCGGCCCGGTCCCGGACGGCGGGCAACTCGGCCTTCCGTAAAGCGGTGGCGCCG
ACGTCTCAAGAAGAGTCGATACTGCTCGACGTGTTGAGTTCCGCCATCCGGCTGAGCCTGGCTCAGGCAGGCGAA
CATGACCGCAGCAAGAAAAGGAGTCACCACCGGAACGAGGCGGCCGAGGCGCACGAGGACACGGCTCTCGAGCTG
ACGACGGTCATACCCAAGCTTCTCAGCAAGTTCGGCGCCGAGCCCGAGACGGCGGCCATCGTGCTCCGGCTAGAA
CACTTTCTCAATCTCGACAGCTTCCAGCAGCTGCGGCAAGACGCGTCCAAGTACGAGAAGCTCCTGGACGAAATC
AGCACCCAATTCATCCGCCACGACGACAAGAGAGTCTTGTTCGAGGCCACGTCGGCGCTGCTTCACGCGCGCCAG
TGCCAGGAGCTGGAGGAGCTGACCGACGGCAAGCTGTCGATGCTCTGGGATAATGTCATCAACGCGCTGCGCAAG
TTCGACGAGACGTGCGAGCTGTCGGTCCGCGGCAACCTCGCGGCCGCTCCCCTGCGAGAGCTGTCTACGACGCTG
GTCAAGATCAGCAAGCTGGCCAGCATCTCGGACTGCGTAGACGCACTCGAGGCCACGTCCAGGTCTGGCGAGTCG
CAGGGTCCGGCCATCGAGATGCTGACCAACGTGGTCCATCGCGGAAAGTATGAGCCGCAAGAGGACGATATCGAT
GACGTAGAGGATGAGGTCGTCTCCTCTGCCATCAAGGCCTGCCAGTTCTACTTTATGTGGAAGACGCGTGCTCTT
GCCCAGCTGCTCGCCGCCGGTACGAGCATCTCAGAAGCCGAGCTCGATAGCCTCTCGGCTCTGCGTCAGTCGTAC
CGCAGGCATCTGATTGAGACGTTTTCGTCGCGGGCCGCCATCGATCAGCTTCGACTCTTCGCGACGGGGAGCCTT
TGCGACCTCCACCTGACGTTGGCCACGCTGCGTCGGCCCTTGCGCGACTCTTCCGATCCAGGCCGGGGGGAGAAG
CTGCGAGTGCTGCTGCAGAATATCGAGCCGGGTCTCGTGCCGGAGTTGACGTCCATCTTCGACGGCGCTGAGAAA
ATGTACGCCAAGAAGGCCAAGAAGGATAAGACGCTCAATGAGCCGGCTGAGGACGAGGACCCGGTTGCCGATGAC
GAGGATCTCGATGACGAGGATGGCGAGGACGATGGCGATGACGAGGGTCAGTCAAGGGAGGAGCGTTACGCCGCT
GAGCTCAGAGCGGAAAAGGCACTCTGCGAGTTGACGGCCAAGTACGTGCTGGCCATGAGGGCCGGACTCATCGAA
GAGCGAGGCCCCCAGCCCGGCAAGCTCCGACGCCGCGTCCTCCGCAACCGTCTCAAGCTGGGGAATAACTTCAAG
GAGGTAGTGGCCTACCTCGACGAGAAGCAACAGCCGGCCAAGCAGCAGGCGGCCAAGAAGCCCGCTTCCACGACG
GCCGCCAAGCAGCAGCAACAGACGGCCAAGCACAAGTCGATTGCCGACGAAGAAGAAGGCGTCTTTGAAGACGTC
GAGCCGGAGGAGGGGTCTCGCGAGGATCTGCGGAGGAGGGAGTTGCTGGATGAGGAGCCGCCTGTTGAGGACGAG
TCTGATGGGGGGGCGGTGGGGAGTTGGCCGATGACGACGTCCTTGGTGATTGAGATGGGGGAGGGGATGGGCATG
GCTTCAAGCTGTTCCTCTGAGTGTACATGTCTTGGGGTGTATGAGGGTGAAGCGTCGTTTTGA
Transcript >Ophcf2|04856
ATGGACGGCAGCCCCAGCGCGAGTTCGGAGACGGAGACTATGACGACGCGTCGCCGATCTGGACGCGTCGTGCGG
CCCCCGGCCAAGTTCGCGTTCAAGCGGAAGAGAGACGACAATGACGCCGATGCCGCCGACGACGATGAGGTTGAC
GACGATGCCGGCTCCGGCTCCGAATCGAGCGACGAGCCTGATGCCGCCAGCGATGCCGACCACCAGCCGCCTAGA
TGGCGCAAGCCGTCGCGCAGCAAGAAGCCCTCGAACAAGAAGCCCAAAATCAACGGCTCGGGACATGTCACTCGC
ATCCCCTCGAGACCGAAGAAAGTGGTTCGAATCGATGCCGGCGAGCATGGTTCCGGTCTCTTTGCCGACATCTTT
GGTTCCGGTGACGCCCCGGACGCCATTGCCAAGGCCTGGCTGGACAAGTATAGGCATGACGACGCGGAGGCCATG
GCTGACTTGGTCAACTGCATCCTTCAATGCGCTGGTTGCGACCTGCAAGTCACGACGGACGACATTCGCGATCCT
GAAAATATCCCGAATCGACTGGTTGATCTTCAGAGCATCCACCAAGAGCAACAAATCACAGATTACCCCTTGATA
GCCAAGGCCAAGAGCACGAGATCCTTTCGCGAGCTGCTCGTCTCCTTTCTCCAACAACTGATGACGCTCCTTCAC
GAGACCGACGTGCTTTACAAAGACGCCGACTTGATCAACAACTTGCACGCATGGCTCTCTAGCATGTCGTCTTCA
TCCCTCCGGCCTTTCCGTCACACAGCGACGACAATAGCCCTCGCCGTGCAGTCGGGCCTCATCGAAGTGGCTGGC
GTGCTCGATCGGCGGATCGCTACCATCGAGCAGCAGTCCCAGGCAGCGAAGAAGGGCAAGAACAAGTCCAAGGCC
GCCGAGATCCAGCGCGGCCTGACAGAGGCCAACGGGTACCGCAAGATGTGCAGCGAGTCGATCCAGTCCTTCTTC
GATACCGTCTTCGTTCACCGTTACCGCGACGTCGACGCCAAGATTCGCACCGAGTGCGTCGAAGCCCTGGGGTCC
TGGATCTGGAACCTACCCACCGTCTTCATGGAGCCGGGTTACCTGCGCTATCTCGGCTGGATGCTCTCGGACACG
TACGCGGCCACACGGCACGAGGTGCTCAAGCAGCTCTTGCGCGTCTTCAAACGTGACGCTCAGCAGCTCGGCCAC
TTCATCGACCGCTTTCGGCCGAGGCTGGTCGAGATGGCCACGCTCGACTCCGAGGTCTCTGTGAGAGTGGCGGCC
ATCTCGGTTATCGACGCGTTACGCGCCGCCGCCCTGCTAGAGCCCAACGAGATTGACGCCATCGGGAAGCTGATA
TTCGATACGGAGCTGCGGATCCGCAAGGCCGTCGTCGGCTTCTTCGTCGCCTGCATCGATGACGTCCATCAGGGC
AAGCTGGATGAGATTGGCGGCGCCGAGGCGCTGGAGGAGCTCGACGATGGCGACCAGGATGACTTTGAGTCGCCG
CGCAAAGAATGGGTCAACATCAAATGCCTGGCCGAGTCTCTCGCCATTTACGACGCCCAGATCGAAGAGGCTCAG
CAGCACGGCGGCCTGGCACCGGACCTGGACGCGGCCGCCGATCTGCTGGACGCGGCCGTGCCTGACACGAGAATA
TCTCTCGCGGCTCAGGTTCTGTACGAGAAGCTGTCCGAGGTCAAGTCGTGGGAGCTGCTCGCGGGATATCTGCTT
TTCGACCACACGACGAGCAAGTCGGCCCGGTCCCGGACGGCGGGCAACTCGGCCTTCCGTAAAGCGGTGGCGCCG
ACGTCTCAAGAAGAGTCGATACTGCTCGACGTGTTGAGTTCCGCCATCCGGCTGAGCCTGGCTCAGGCAGGCGAA
CATGACCGCAGCAAGAAAAGGAGTCACCACCGGAACGAGGCGGCCGAGGCGCACGAGGACACGGCTCTCGAGCTG
ACGACGGTCATACCCAAGCTTCTCAGCAAGTTCGGCGCCGAGCCCGAGACGGCGGCCATCGTGCTCCGGCTAGAA
CACTTTCTCAATCTCGACAGCTTCCAGCAGCTGCGGCAAGACGCGTCCAAGTACGAGAAGCTCCTGGACGAAATC
AGCACCCAATTCATCCGCCACGACGACAAGAGAGTCTTGTTCGAGGCCACGTCGGCGCTGCTTCACGCGCGCCAG
TGCCAGGAGCTGGAGGAGCTGACCGACGGCAAGCTGTCGATGCTCTGGGATAATGTCATCAACGCGCTGCGCAAG
TTCGACGAGACGTGCGAGCTGTCGGTCCGCGGCAACCTCGCGGCCGCTCCCCTGCGAGAGCTGTCTACGACGCTG
GTCAAGATCAGCAAGCTGGCCAGCATCTCGGACTGCGTAGACGCACTCGAGGCCACGTCCAGGTCTGGCGAGTCG
CAGGGTCCGGCCATCGAGATGCTGACCAACGTGGTCCATCGCGGAAAGTATGAGCCGCAAGAGGACGATATCGAT
GACGTAGAGGATGAGGTCGTCTCCTCTGCCATCAAGGCCTGCCAGTTCTACTTTATGTGGAAGACGCGTGCTCTT
GCCCAGCTGCTCGCCGCCGGTACGAGCATCTCAGAAGCCGAGCTCGATAGCCTCTCGGCTCTGCGTCAGTCGTAC
CGCAGGCATCTGATTGAGACGTTTTCGTCGCGGGCCGCCATCGATCAGCTTCGACTCTTCGCGACGGGGAGCCTT
TGCGACCTCCACCTGACGTTGGCCACGCTGCGTCGGCCCTTGCGCGACTCTTCCGATCCAGGCCGGGGGGAGAAG
CTGCGAGTGCTGCTGCAGAATATCGAGCCGGGTCTCGTGCCGGAGTTGACGTCCATCTTCGACGGCGCTGAGAAA
ATGTACGCCAAGAAGGCCAAGAAGGATAAGACGCTCAATGAGCCGGCTGAGGACGAGGACCCGGTTGCCGATGAC
GAGGATCTCGATGACGAGGATGGCGAGGACGATGGCGATGACGAGGGTCAGTCAAGGGAGGAGCGTTACGCCGCT
GAGCTCAGAGCGGAAAAGGCACTCTGCGAGTTGACGGCCAAGTACGTGCTGGCCATGAGGGCCGGACTCATCGAA
GAGCGAGGCCCCCAGCCCGGCAAGCTCCGACGCCGCGTCCTCCGCAACCGTCTCAAGCTGGGGAATAACTTCAAG
GAGGTAGTGGCCTACCTCGACGAGAAGCAACAGCCGGCCAAGCAGCAGGCGGCCAAGAAGCCCGCTTCCACGACG
GCCGCCAAGCAGCAGCAACAGACGGCCAAGCACAAGTCGATTGCCGACGAAGAAGAAGGCGTCTTTGAAGACGTC
GAGCCGGAGGAGGGGTCTCGCGAGGATCTGCGGAGGAGGGAGTTGCTGGATGAGGAGCCGCCTGTTGAGGACGAG
TCTGATGGGGGGGCGGTGGGGAGTTGGCCGATGACGACGTCCTTGGTGATTGAGATGGGGGAGGGGATGGGCATG
GCTTCAAGCTGTTCCTCTGAGTGTACATGTCTTGGGGTGTATGAGGGTGAAGCGTCGTTTTGA
Gene >Ophcf2|04856
ATGGACGGCAGCCCCAGCGCGAGTTCGGAGACGGAGACTATGACGACGCGTCGCCGATCTGGACGCGTCGTGCGG
CCCCCGGCCAAGTTCGCGTTCAAGCGGAAGAGAGACGACAATGACGCCGATGCCGCCGACGACGATGAGGTTGAC
GACGATGCCGGCTCCGGCTCCGAATCGAGCGACGAGCCTGATGCCGCCAGCGATGCCGACCACCAGCCGCCTAGA
TGGCGCAAGCCGTCGCGCAGCAAGAAGCCCTCGAACAAGAAGCCCAAAATCAACGGCTCGGGACATGTCACTCGC
ATCCCCTCGAGACCGAAGAAAGTGGTTCGAATCGATGCCGGCGAGCATGGTTCCGGTCTCTTTGGTAGGTGCAAG
TCGTCCGCCTCGCGCTTGATCGGGAGCTGACGAAGGCCTCGCAGCCGACATCTTTGGTTCCGGTGACGCCCCGGA
CGCCATTGCCAAGGCCTGGCTGGACAAGTATAGGCATGACGACGCGGAGGCCATGGCTGACTTGGTCAACTGCAT
CCTTCAATGCGCTGGTTGCGACCTGCAAGTCACGACGGACGACATTCGCGATCCTGAAAATATCCCGAATCGACT
GGTTGATCTTCAGAGCATCCACCAAGAGGTGCGCAGTATCCAATCGTGCCCCATAGTGCCCCTCGGCGTCTTGTC
CATTGCTGACGAAAAATCCTTGTAGCAACAAATCACAGATTACCCCTTGATAGCCAAGGCCAAGAGCACGAGATC
CTTTCGCGAGCTGCTCGTCTCCTTTCTCCAACAACTGATGACGCTCCTTCACGAGACCGACGTGCTTTACAAAGA
CGCCGACTTGATCAACAACTTGCACGCATGGCTCTCTAGCATGTCGTCTTCATCCCTCCGGCCTTTCCGTCACAC
AGCGACGACAATAGCCCTCGCCGTGCAGTCGGGCCTCATCGAAGTGGCTGGCGTGCTCGATCGGCGGATCGCTAC
CATCGAGCAGCAGTCCCAGGCAGCGAAGAAGGGCAAGAACAAGTCCAAGGCCGCCGAGATCCAGCGCGGCCTGAC
AGAGGCCAACGGGTACCGCAAGATGTGCAGCGAGTCGATCCAGTCCTTCTTCGATACCGTCTTCGTTCACCGTTA
CCGCGACGTCGACGCCAAGATTCGCACCGAGTGCGTCGAAGCCCTGGGGTCCTGGATCTGGAACCTACCCACCGT
CTTCATGGAGCCGGGTTACCTGCGCTATCTCGGCTGGATGCTCTCGGACACGTACGCGGCCACACGGCACGAGGT
GCTCAAGCAGCTCTTGCGCGTCTTCAAACGTGACGCTCAGCAGCTCGGCCACTTCATCGACCGCTTTCGGCCGAG
GCTGGTCGAGATGGCCACGCTCGACTCCGAGGTCTCTGTGAGAGTGGCGGCCATCTCGGTTATCGACGCGTTACG
CGCCGCCGCCCTGCTAGAGCCCAACGAGATTGACGCCATCGGGAAGCTGATATTCGATACGGAGCTGCGGATCCG
CAAGGCCGTCGTCGGCTTCTTCGTCGCCTGCATCGATGACGTCCATCAGGGCAAGCTGGATGAGATTGGCGGCGC
CGAGGCGCTGGAGGAGCTCGACGATGGCGACCAGGATGACTTTGAGTCGCCGCGCAAAGAATGGGTCAACATCAA
ATGCCTGGCCGAGTCTCTCGCCATTTACGACGCCCAGATCGAAGAGGCTCAGCAGCACGGCGGCCTGGCACCGGA
CCTGGACGCGGCCGCCGATCTGCTGGACGCGGCCGTGCCTGACACGAGAATATCTCTCGCGGCTCAGGTTCTGTA
CGAGAAGCTGTCCGAGGTCAAGTCGTGGGAGCTGCTCGCGGGATATCTGCTTTTCGACCACACGACGAGCAAGTC
GGCCCGGTCCCGGACGGCGGGCAACTCGGCCTTCCGTAAAGCGGTGGCGCCGACGTCTCAAGAAGAGTCGATACT
GCTCGACGTGTTGAGTTCCGCCATCCGGCTGAGCCTGGCTCAGGCAGGCGAACATGACCGCAGCAAGAAAAGGAG
TCACCACCGGAACGAGGCGGCCGAGGCGCACGAGGACACGGCTCTCGAGCTGACGACGGTCATACCCAAGCTTCT
CAGCAAGTTCGGCGCCGAGCCCGAGACGGCGGCCATCGTGCTCCGGCTAGAACACTTTCTCAATCTCGACAGCTT
CCAGCAGCTGCGGCAAGACGCGTCCAAGTACGAGAAGCTCCTGGACGAAATCAGCACCCAATTCATCCGCCACGA
CGACAAGAGAGTCTTGTTCGAGGCCACGTCGGCGCTGCTTCACGCGCGCCAGTGCCAGGAGCTGGAGGAGCTGAC
CGACGGCAAGCTGTCGATGCTCTGGGATAATGTCATCAACGCGCTGCGCAAGTTCGACGAGACGTGCGAGCTGTC
GGTCCGCGGCAACCTCGCGGCCGCTCCCCTGCGAGAGCTGTCTACGACGCTGGTCAAGATCAGCAAGCTGGCCAG
CATCTCGGACTGCGTAGACGCACTCGAGGCCACGTCCAGGTCTGGCGAGTCGCAGGGTCCGGCCATCGAGATGCT
GACCAACGTGGTCCATCGCGGAAAGTATGAGCCGCAAGAGGACGATATCGATGACGTAGAGGATGAGGTCGTCTC
CTCTGCCATCAAGGCCTGCCAGTTCTACTTTATGTGGAAGACGCGTGCTCTTGCCCAGCTGCTCGCCGCCGGTAC
GAGCATCTCAGAAGCCGAGCTCGATAGCCTCTCGGCTCTGCGTCAGTCGTACCGCAGGCATCTGATTGAGACGTT
TTCGTCGCGGGCCGCCATCGATCAGCTTCGACTCTTCGCGACGGGGAGCCTTTGCGACCTCCACCTGACGTTGGC
CACGCTGCGTCGGCCCTTGCGCGACTCTTCCGATCCAGGCCGGGGGGAGAAGCTGCGAGTGCTGCTGCAGAATAT
CGAGCCGGGTCTCGTGCCGGAGTTGACGTCCATCTTCGACGGCGCTGAGAAAATGTACGCCAAGAAGGCCAAGAA
GGATAAGACGCTCAATGAGCCGGCTGAGGACGAGGACCCGGTTGCCGATGACGAGGATCTCGATGACGAGGATGG
CGAGGACGATGGCGATGACGAGGGTCAGTCAAGGGAGGAGCGTTACGCCGCTGAGCTCAGAGCGGAAAAGGCACT
CTGCGAGTTGACGGCCAAGTACGTGCTGGCCATGAGGGCCGGACTCATCGAAGAGCGAGGCCCCCAGCCCGGCAA
GCTCCGACGCCGCGTCCTCCGCAACCGTCTCAAGCTGGGGAATAACTTCAAGGAGGTAGTGGCCTACCTCGACGA
GAAGCAACAGCCGGCCAAGCAGCAGGCGGCCAAGAAGCCCGCTTCCACGACGGCCGCCAAGCAGCAGCAACAGAC
GGCCAAGCACAAGTCGATTGCCGACGAAGAAGAAGGCGTCTTTGAAGACGTCGAGCCGGAGGAGGGGTCTCGCGA
GGATCTGCGGAGGAGGGAGTTGCTGGATGAGGAGCCGCCTGTTGAGGACGAGTCTGATGGGGGGGCGGTGGGGAG
TTGGCCGATGACGACGTCCTTGGTGATTGAGATGGGGGAGGGGATGGGCATGGCTTCAAGCTGTTCCTCTGAGTG
TACATGTCTTGGGGTGTATGAGGGTGAAGCGTCGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail