Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04851
Gene name
Locationscaffold_05:1778708..1781379
Strand+
Gene length (bp)2671
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 735 757 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 27.88 15.62 40.14
Alive In ants, during behavior modification 30.53 17.09 43.97
Dead In ants, recently dead 29.17 16.34 42.00

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.682225 no
Alive Dead 0.826695 no
Dead Fungus 0.849595 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04851
MHTGSLFFCHPSLSQEHGHPPSPRLLRRSPTLRKLCGRRRRSSQARSRRLESALTLSRLAGYGATPSGPFLGAIP
PAQPSRVCPHTHTQAPQHKTRKSYSPSPPVACPDTHPAFDPISISPHLIVMASMSPIDTSAAAISGPSSNAGSVS
PRQTATPKNVAFELMFSNSPQYRARLPMRVQIYPHDTTDSIVTTVKNFYGLYSGPSGSKGVSFEDDNGNTLIARY
ENFANNMIVYVRVIEEPPPAFAPQPFQAASAVEPEPYFAADACPAQQPQQRLDNDILRPGSRASRRRSTSPSAAR
RRRSVSASTSCKKGRSRSFKKRGSVAGGHGDACSDSINGYSSGDGAPSTVSAKNKEHLGNTDISVDNIVEGGRRK
RAKFESSELPLFAPPQMPAATSNPSVSPARRVDHQRPSMPFVHPGQSPFTNPRPMQSPQSYGAGVVHAAMYATPV
SQGHRSRGSMGYPSSGATGLGVLPTPDPTVGSCMSEEDKDVAIQLMRLGESSNISHGRTSASTMDDTFSGRADVA
SSTGATSDGSDSERDGPAPRRQKLDASGGSRPIYETTESHFMPTTEGGDVSADEADVDDGANSSVGDGRVVPHAK
PAAAKKQSSAKPKATTKLAKSKVARPPSSKAKKPPVVAPPAGPMSPTSLTHSRKQSVASIGLASQPGEDEQPDLS
TKPRCQRCRKSKKGCDRQRPCGRCRDAGLSADQCISEDEGNGRKGRYGRHMGVPIKQEDAASMAAVPGLLPAAPI
TAAVGAADKVKKRKR*
Coding >Ophcf2|04851
ATGCACACGGGCAGCCTCTTCTTCTGCCATCCATCATTATCGCAAGAGCACGGCCACCCTCCGTCGCCTCGTCTG
CTCCGTCGGTCGCCCACTCTCCGCAAACTCTGCGGTAGACGTCGTCGCTCGTCGCAAGCCCGGAGCCGACGGCTC
GAGTCGGCGCTTACTCTCAGCAGGCTCGCCGGCTACGGAGCGACGCCGTCCGGGCCCTTCCTTGGGGCCATACCG
CCTGCTCAGCCCTCTCGGGTCTGCCCACACACGCACACACAAGCACCGCAACACAAAACCCGCAAATCCTACTCC
CCCTCTCCTCCCGTCGCCTGCCCCGACACACACCCAGCCTTTGATCCCATTTCCATCTCTCCTCATCTCATCGTC
ATGGCCTCCATGTCGCCCATAGACACCTCGGCTGCCGCCATCTCGGGGCCTTCGTCCAACGCCGGCAGCGTCTCG
CCGCGACAGACGGCCACGCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGT
CTCCCCATGCGGGTCCAGATCTATCCTCATGATACCACCGACTCCATCGTCACTACCGTTAAGAATTTCTACGGC
CTATACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTTGAGGACGATAACGGCAACACGCTCATCGCGCGCTAC
GAGAACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCCCCCCCGGCCTTTGCGCCGCAACCG
TTCCAAGCCGCGTCCGCCGTCGAGCCCGAACCCTACTTCGCCGCCGACGCCTGTCCGGCCCAACAGCCCCAGCAG
CGCTTAGACAACGACATTCTCCGACCCGGCTCCCGGGCATCGCGACGTCGCAGTACCTCGCCCAGCGCCGCCCGC
CGTCGCCGGAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGCCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTG
GCCGGCGGCCATGGTGACGCATGTAGCGACAGCATCAACGGTTACAGCAGCGGCGACGGCGCCCCCAGCACCGTC
TCTGCCAAGAACAAGGAGCACCTGGGCAATACTGACATCAGCGTCGATAACATTGTCGAGGGAGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGAGCTGCCTTTGTTTGCGCCGCCCCAGATGCCGGCGGCCACTTCCAACCCATCG
GTGTCTCCGGCCCGCCGCGTCGATCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCCCCTTTACA
AACCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGCCGGCGTCGTCCACGCTGCCATGTACGCCACTCCCGTC
AGCCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCCTGCCCACG
CCGGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGCTCGGTGAG
TCGTCCAACATCTCGCACGGCCGCACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCGACGTCGCT
TCCTCAACCGGCGCCACCAGTGATGGAAGTGACAGCGAGCGCGATGGCCCCGCGCCTCGTCGCCAGAAGCTCGAC
GCGTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTCATGCCTACGACGGAGGGAGGCGACGTC
AGCGCTGACGAAGCCGATGTCGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAGGGTAGTTCCCCACGCCAAG
CCTGCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCTAAGGCGACCACTAAGCTCGCCAAGTCCAAGGTCGCCCGA
CCTCCCAGCTCCAAGGCCAAGAAGCCGCCGGTCGTGGCGCCGCCGGCCGGACCCATGTCGCCGACGTCCCTCACG
CACTCGCGAAAGCAGTCGGTGGCCTCGATCGGGCTGGCGTCTCAACCCGGCGAGGACGAGCAGCCGGACCTTTCC
ACCAAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGTTGCGACCGCCAGCGCCCGTGCGGACGTTGCCGC
GACGCGGGGCTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGTCGATATGGTCGCCAC
ATGGGCGTCCCCATCAAGCAAGAAGATGCCGCCTCGATGGCCGCCGTGCCCGGTCTGCTACCCGCCGCCCCCATC
ACGGCCGCTGTGGGAGCTGCGGACAAGGTCAAGAAGCGCAAGCGGTAG
Transcript >Ophcf2|04851
ATGCACACGGGCAGCCTCTTCTTCTGCCATCCATCATTATCGCAAGAGCACGGCCACCCTCCGTCGCCTCGTCTG
CTCCGTCGGTCGCCCACTCTCCGCAAACTCTGCGGTAGACGTCGTCGCTCGTCGCAAGCCCGGAGCCGACGGCTC
GAGTCGGCGCTTACTCTCAGCAGGCTCGCCGGCTACGGAGCGACGCCGTCCGGGCCCTTCCTTGGGGCCATACCG
CCTGCTCAGCCCTCTCGGGTCTGCCCACACACGCACACACAAGCACCGCAACACAAAACCCGCAAATCCTACTCC
CCCTCTCCTCCCGTCGCCTGCCCCGACACACACCCAGCCTTTGATCCCATTTCCATCTCTCCTCATCTCATCGTC
ATGGCCTCCATGTCGCCCATAGACACCTCGGCTGCCGCCATCTCGGGGCCTTCGTCCAACGCCGGCAGCGTCTCG
CCGCGACAGACGGCCACGCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGT
CTCCCCATGCGGGTCCAGATCTATCCTCATGATACCACCGACTCCATCGTCACTACCGTTAAGAATTTCTACGGC
CTATACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTTGAGGACGATAACGGCAACACGCTCATCGCGCGCTAC
GAGAACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCCCCCCCGGCCTTTGCGCCGCAACCG
TTCCAAGCCGCGTCCGCCGTCGAGCCCGAACCCTACTTCGCCGCCGACGCCTGTCCGGCCCAACAGCCCCAGCAG
CGCTTAGACAACGACATTCTCCGACCCGGCTCCCGGGCATCGCGACGTCGCAGTACCTCGCCCAGCGCCGCCCGC
CGTCGCCGGAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGCCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTG
GCCGGCGGCCATGGTGACGCATGTAGCGACAGCATCAACGGTTACAGCAGCGGCGACGGCGCCCCCAGCACCGTC
TCTGCCAAGAACAAGGAGCACCTGGGCAATACTGACATCAGCGTCGATAACATTGTCGAGGGAGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGAGCTGCCTTTGTTTGCGCCGCCCCAGATGCCGGCGGCCACTTCCAACCCATCG
GTGTCTCCGGCCCGCCGCGTCGATCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCCCCTTTACA
AACCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGCCGGCGTCGTCCACGCTGCCATGTACGCCACTCCCGTC
AGCCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCCTGCCCACG
CCGGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGCTCGGTGAG
TCGTCCAACATCTCGCACGGCCGCACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCGACGTCGCT
TCCTCAACCGGCGCCACCAGTGATGGAAGTGACAGCGAGCGCGATGGCCCCGCGCCTCGTCGCCAGAAGCTCGAC
GCGTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTCATGCCTACGACGGAGGGAGGCGACGTC
AGCGCTGACGAAGCCGATGTCGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAGGGTAGTTCCCCACGCCAAG
CCTGCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCTAAGGCGACCACTAAGCTCGCCAAGTCCAAGGTCGCCCGA
CCTCCCAGCTCCAAGGCCAAGAAGCCGCCGGTCGTGGCGCCGCCGGCCGGACCCATGTCGCCGACGTCCCTCACG
CACTCGCGAAAGCAGTCGGTGGCCTCGATCGGGCTGGCGTCTCAACCCGGCGAGGACGAGCAGCCGGACCTTTCC
ACCAAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGTTGCGACCGCCAGCGCCCGTGCGGACGTTGCCGC
GACGCGGGGCTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGTCGATATGGTCGCCAC
ATGGGCGTCCCCATCAAGCAAGAAGATGCCGCCTCGATGGCCGCCGTGCCCGGTCTGCTACCCGCCGCCCCCATC
ACGGCCGCTGTGGGAGCTGCGGACAAGGTCAAGAAGCGCAAGCGGTAG
Gene >Ophcf2|04851
ATGCACACGGGCAGCCTCTTCTTCTGCCATCCATCATTATCGCAAGAGCACGGCCACCCTCCGTCGCCTCGTCTG
CTGTAAGCCATCGCTCCTTTGTCTTGATCTTACCCTCGTCTTTCCCGTCTCCTGACTCTCACGGAAGCGAGCTGC
TTCGTCGGTCGCCTTTCTCTCCTCTTCTCTCCCCCCCCCCCCCCCCCCCCAAATCATGGCCACCCCCCTCTCAAA
GAGAGACTCTGGCTACGATTCGCCTCTCCCTCCTTCACCGAGCTGAATCGTTTGACTGATTGCATCGTCTGTTCT
AGCCGTCGGTCGCCCACTCTCCGCAAACTCTGCGGTAGACGTCGTCGCTCGTCGCAAGCCCGGAGCCGACGGCTC
GAGTCGGCGCTTACTGTCTGCGGCCGCCTTTCCCTCGCACCACCAAGCGTCTCGACAGCCTGTTCTGTTGACGAA
TCGAAGTCAAGCTCAGCAGGCTCGCCGGCTACGGAGCGACGCCGTCCGGGCCCTTCCTTGGGGCCATACCGCCTG
CTCAGCCCTCTCGGGTCTGCCCACACACGCACACACAAGCACCGCAACACAAAACCCGCAAATCCTACTCCCCCT
CTCCTCCCGTCGCCTGCCCCGACACACACCCAGCCTTTGATCCCATTTCCATCTCTCCTCATCTCATCGTCATGG
CCTCCATGTCGCCCATAGACACCTCGGCTGCCGCCATCTCGGGGCCTTCGTCCAACGCCGGCAGCGTCTCGCCGC
GACAGACGGCCACGCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCGCAGTATCGCGCGCGTCTCC
CCATGCGGGTCCAGATCTATCCTCATGATACCACCGACTCCATCGTCACTACCGTTAAGAATTTCTACGGCCTAT
ACTCTGGTCCGTCCGGCTCAAAGGGCGTCAGCTTTGAGGACGATAACGGCAACACGCTCATCGCGCGCTACGAGA
ACTTCGCCAACAACATGATCGTCTACGTCCGCGTAATAGAGGAGCCCCCCCCGGCCTTTGCGCCGCAACCGTTCC
AAGCCGCGTCCGCCGTCGAGCCCGAACCCTACTTCGCCGCCGACGCCTGTCCGGCCCAACAGCCCCAGCAGCGCT
TAGACAACGACATTCTCCGACCCGGCTCCCGGGCATCGCGACGTCGCAGTACCTCGCCCAGCGCCGCCCGCCGTC
GCCGGAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGCCGCTCTCGGTCGTTCAAGAAGCGAGGGTCCGTGGCCG
GCGGCCATGGTGACGCATGTAGCGACAGCATCAACGGTTACAGCAGCGGCGACGGCGCCCCCAGCACCGTCTCTG
CCAAGAACAAGGAGCACCTGGGCAATACTGACATCAGCGTCGATAACATTGTCGAGGGAGGCCGGCGCAAGAGGG
CCAAGTTTGAGAGCTCGGTAGGCATTTCCCGTCTCGCTCCCTTGTGCAGCACCGTCGTCCATGTCCTCTTCCGCA
AACTGACGGTCCGCTCAAGGAGCTGCCTTTGTTTGCGCCGCCCCAGATGCCGGCGGCCACTTCCAACCCATCGGT
GTCTCCGGCCCGCCGCGTCGATCACCAGCGGCCGTCGATGCCGTTTGTCCACCCGGGCCAGAGCCCCTTTACAAA
CCCGCGGCCCATGCAGTCGCCGCAGAGCTACGGCGCCGGCGTCGTCCACGCTGCCATGTACGCCACTCCCGTCAG
CCAGGGTCACCGCTCGCGCGGCAGCATGGGCTACCCCAGCAGCGGCGCCACCGGCCTTGGCGTCCTGCCCACGCC
GGATCCCACCGTCGGCAGCTGCATGTCGGAAGAGGACAAGGACGTCGCCATTCAGCTCATGAGGCTCGGTGAGTC
GTCCAACATCTCGCACGGCCGCACCTCGGCCTCTACCATGGACGACACCTTCAGCGGCCGGGCCGACGTCGCTTC
CTCAACCGGCGCCACCAGTGATGGAAGTGACAGCGAGCGCGATGGCCCCGCGCCTCGTCGCCAGAAGCTCGACGC
GTCCGGCGGTTCGCGGCCCATCTATGAGACGACCGAGTCGCACTTCATGCCTACGACGGAGGGAGGCGACGTCAG
CGCTGACGAAGCCGATGTCGACGACGGCGCAAACAGCTCGGTAGGAGACGGCAGGGTAGTTCCCCACGCCAAGCC
TGCCGCCGCCAAGAAGCAATCGTCGGCCAAGCCTAAGGCGACCACTAAGCTCGCCAAGTCCAAGGTCGCCCGACC
TCCCAGCTCCAAGGCCAAGAAGCCGCCGGTCGTGGCGCCGCCGGCCGGACCCATGTCGCCGACGTCCCTCACGCA
CTCGCGAAAGCAGTCGGTGGCCTCGATCGGGCTGGCGTCTCAACCCGGCGAGGACGAGCAGCCGGACCTTTCCAC
CAAGCCCCGGTGCCAGCGATGCCGCAAGAGCAAAAAGGGTTGCGACCGCCAGCGCCCGTGCGGACGTTGCCGCGA
CGCGGGGCTCTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGACGCAAGGGTCGATATGGTCGCCACAT
GGGCGTCCCCATCAAGCAAGAAGATGCCGCCTCGATGGCCGCCGTGCCCGGTCTGCTACCCGCCGCCCCCATCAC
GGCCGCTGTGGGAGCTGCGGACAAGGTCAAGAAGCGCAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail