Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04848
Gene name
Locationscaffold_05:1768682..1770984
Strand-
Gene length (bp)2302
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 8.0E-25 346 436
PF00153 Mito_carr Mitochondrial carrier protein 2.1E-18 440 528
PF00153 Mito_carr Mitochondrial carrier protein 8.0E-23 538 628
PF13499 EF-hand_7 EF-hand domain pair 2.3E-09 176 271
PF00036 EF-hand_1 EF hand 2.0E-07 178 204
PF13405 EF-hand_6 EF-hand domain 1.8E-07 178 203
PF13202 EF-hand_5 EF hand 3.4E-06 178 201

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2206 0.1312 0.0472 0.2766 0.8481 0.1468 0.2653 0.1819 0.2087 0.0948

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3728
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1629
Ophiocordyceps australis map64 (Brazil) OphauB2|5836
Ophiocordyceps camponoti-floridani Ophcf2|04848 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6103
Ophiocordyceps kimflemingae Ophio5|7370
Ophiocordyceps subramaniannii Hirsu2|7278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04848
MAKATAVRAAVKETLLGSGEEPPQLSAQSRARFVACAVKDADTDELYMGPDEFINAVAPKDEDYHKIRREQYSIL
FRVADSRGIGRVSMSDWSVFENLLMKPDAEYEIAFRLFDVDRTGTVKHQDVRRLYELNKGPDHLPFDWDCEWARL
HMGSKKNRHELGYPQFSQMLRGLQGERIRQAFQLLDRDGDGYITPDEFERIIRETSRHKLSDHLLENLHTLCNIA
VGTKISYANVRAFQNVMQQVDHVERIIRSAVARSADGKITRAEFVREAARVTRFSLFTPMEADILFHFASLDEPS
GRLGLGDFAKVLDPSWKSRAYESEYHSSLSSSGTGSTALRKAAESTYNFALGSLAGAFGAFMVYPIDLVKTRLQN
QRGALPGQRLYKNSIDCFQKVFRNEGIRGLYSGVLPQLVGVAPEKAIKLTVNDLVRGYLTDQEGKIPWWSEVAAG
ASAGGCQVIFTNPLEIVKIRLQVQGEVAKTVNATPKRSAMWIVRNLGLVGLYKGASACLLRDVPFSAIYFPTYSH
LKKDMFGESATKKLGVLQLLTAGAMAGMPAAYLTTPCDVIKTRLQVEARKGEASYTGLRHAAKTIWREEGFRAFF
RGGPARIFRSSPQFGFTLAAYEVLQNMVPMPGTAKTEVRMQQATATATGAEGDMTPWGRSRNALKMILDLDEDFG
MAKLPDEKGWRSLPRFMGGGGGQAQG*
Coding >Ophcf2|04848
ATGGCCAAGGCCACAGCTGTCAGGGCGGCGGTCAAGGAGACGCTGCTGGGCTCGGGCGAGGAGCCGCCGCAGCTT
TCGGCTCAGAGTCGGGCGCGCTTTGTTGCCTGCGCGGTTAAGGATGCCGATACCGACGAGTTATACATGGGGCCT
GATGAGTTTATCAATGCTGTGGCGCCCAAGGATGAGGACTACCATAAGATCAGGCGCGAACAGTACTCGATTCTC
TTTCGTGTCGCCGACAGCAGAGGCATTGGCAGGGTCTCCATGTCCGACTGGAGCGTCTTCGAGAACCTCCTGATG
AAGCCCGACGCCGAATACGAAATCGCATTCCGGCTCTTCGACGTCGACCGCACCGGCACCGTCAAGCACCAGGAC
GTCCGTCGGTTGTACGAGCTTAACAAGGGTCCCGATCATCTCCCCTTCGACTGGGACTGCGAGTGGGCGCGCCTG
CACATGGGCAGCAAGAAGAATCGACACGAGCTCGGCTATCCGCAGTTCTCGCAGATGCTGCGCGGCCTTCAGGGG
GAGCGCATTCGTCAGGCTTTTCAGCTGCTCGACCGAGATGGTGACGGCTACATCACCCCAGACGAGTTTGAGCGC
ATCATCCGCGAGACGTCGCGCCATAAGCTGTCGGATCATCTGCTCGAGAACTTGCATACGCTCTGCAACATCGCG
GTCGGCACCAAGATCTCGTACGCCAACGTGCGTGCCTTTCAGAACGTCATGCAGCAGGTGGACCATGTCGAGCGC
ATCATCCGCAGTGCCGTCGCTCGCAGCGCCGATGGCAAGATTACACGCGCCGAGTTTGTCCGGGAGGCCGCACGC
GTCACCCGCTTCTCCCTCTTCACCCCGATGGAGGCCGACATCCTGTTTCATTTTGCCAGCCTGGATGAGCCGTCG
GGTCGGCTGGGGCTGGGAGACTTTGCCAAGGTGCTGGACCCATCTTGGAAGAGCCGGGCGTACGAGAGCGAATAC
CATTCATCCCTCTCCTCGTCCGGGACGGGGTCGACGGCGCTGCGCAAGGCGGCCGAGTCGACGTACAACTTTGCG
CTGGGAAGTCTGGCTGGCGCGTTTGGCGCCTTTATGGTGTATCCGATCGACCTGGTCAAGACGCGGCTGCAGAAC
CAGCGAGGCGCGCTGCCGGGTCAGCGGCTGTACAAGAACTCGATCGACTGCTTCCAAAAGGTGTTTCGAAACGAG
GGCATCCGCGGTCTTTACTCCGGCGTGCTGCCGCAGCTGGTGGGCGTGGCGCCGGAGAAGGCCATCAAGTTGACG
GTCAACGACCTGGTCCGAGGATACCTGACGGACCAGGAGGGCAAGATTCCGTGGTGGTCCGAGGTGGCGGCGGGT
GCGAGTGCCGGAGGGTGCCAGGTGATCTTTACCAACCCCCTCGAAATCGTCAAGATCCGGCTTCAGGTGCAGGGC
GAGGTGGCCAAGACGGTCAACGCGACGCCCAAGCGATCGGCCATGTGGATCGTGCGCAACCTGGGTCTGGTCGGG
CTGTACAAGGGGGCGTCGGCGTGTCTGTTGCGCGACGTGCCCTTCTCGGCCATTTACTTTCCGACGTACAGCCAC
CTGAAGAAGGACATGTTTGGCGAGTCGGCGACCAAGAAGCTCGGGGTGTTGCAGCTGCTGACGGCGGGTGCCATG
GCGGGCATGCCTGCTGCTTACCTGACGACACCCTGCGATGTGATCAAGACGCGATTGCAGGTGGAGGCTCGCAAG
GGAGAGGCGTCGTACACGGGTCTGCGGCACGCGGCCAAGACCATCTGGCGCGAGGAGGGCTTCCGGGCCTTTTTC
CGGGGCGGACCGGCGCGCATCTTCCGGTCGTCGCCGCAGTTCGGCTTCACGCTGGCGGCGTACGAGGTGCTGCAG
AACATGGTACCCATGCCGGGAACGGCCAAGACGGAGGTGCGGATGCAGCAGGCGACGGCGACGGCGACGGGGGCC
GAGGGGGACATGACGCCTTGGGGACGCAGCCGGAACGCGCTCAAGATGATCCTCGACCTGGATGAGGACTTTGGC
ATGGCGAAGCTGCCGGATGAAAAGGGGTGGCGGTCTTTGCCGCGCTTCATGGGGGGCGGGGGCGGACAGGCTCAG
GGATAG
Transcript >Ophcf2|04848
ATGGCCAAGGCCACAGCTGTCAGGGCGGCGGTCAAGGAGACGCTGCTGGGCTCGGGCGAGGAGCCGCCGCAGCTT
TCGGCTCAGAGTCGGGCGCGCTTTGTTGCCTGCGCGGTTAAGGATGCCGATACCGACGAGTTATACATGGGGCCT
GATGAGTTTATCAATGCTGTGGCGCCCAAGGATGAGGACTACCATAAGATCAGGCGCGAACAGTACTCGATTCTC
TTTCGTGTCGCCGACAGCAGAGGCATTGGCAGGGTCTCCATGTCCGACTGGAGCGTCTTCGAGAACCTCCTGATG
AAGCCCGACGCCGAATACGAAATCGCATTCCGGCTCTTCGACGTCGACCGCACCGGCACCGTCAAGCACCAGGAC
GTCCGTCGGTTGTACGAGCTTAACAAGGGTCCCGATCATCTCCCCTTCGACTGGGACTGCGAGTGGGCGCGCCTG
CACATGGGCAGCAAGAAGAATCGACACGAGCTCGGCTATCCGCAGTTCTCGCAGATGCTGCGCGGCCTTCAGGGG
GAGCGCATTCGTCAGGCTTTTCAGCTGCTCGACCGAGATGGTGACGGCTACATCACCCCAGACGAGTTTGAGCGC
ATCATCCGCGAGACGTCGCGCCATAAGCTGTCGGATCATCTGCTCGAGAACTTGCATACGCTCTGCAACATCGCG
GTCGGCACCAAGATCTCGTACGCCAACGTGCGTGCCTTTCAGAACGTCATGCAGCAGGTGGACCATGTCGAGCGC
ATCATCCGCAGTGCCGTCGCTCGCAGCGCCGATGGCAAGATTACACGCGCCGAGTTTGTCCGGGAGGCCGCACGC
GTCACCCGCTTCTCCCTCTTCACCCCGATGGAGGCCGACATCCTGTTTCATTTTGCCAGCCTGGATGAGCCGTCG
GGTCGGCTGGGGCTGGGAGACTTTGCCAAGGTGCTGGACCCATCTTGGAAGAGCCGGGCGTACGAGAGCGAATAC
CATTCATCCCTCTCCTCGTCCGGGACGGGGTCGACGGCGCTGCGCAAGGCGGCCGAGTCGACGTACAACTTTGCG
CTGGGAAGTCTGGCTGGCGCGTTTGGCGCCTTTATGGTGTATCCGATCGACCTGGTCAAGACGCGGCTGCAGAAC
CAGCGAGGCGCGCTGCCGGGTCAGCGGCTGTACAAGAACTCGATCGACTGCTTCCAAAAGGTGTTTCGAAACGAG
GGCATCCGCGGTCTTTACTCCGGCGTGCTGCCGCAGCTGGTGGGCGTGGCGCCGGAGAAGGCCATCAAGTTGACG
GTCAACGACCTGGTCCGAGGATACCTGACGGACCAGGAGGGCAAGATTCCGTGGTGGTCCGAGGTGGCGGCGGGT
GCGAGTGCCGGAGGGTGCCAGGTGATCTTTACCAACCCCCTCGAAATCGTCAAGATCCGGCTTCAGGTGCAGGGC
GAGGTGGCCAAGACGGTCAACGCGACGCCCAAGCGATCGGCCATGTGGATCGTGCGCAACCTGGGTCTGGTCGGG
CTGTACAAGGGGGCGTCGGCGTGTCTGTTGCGCGACGTGCCCTTCTCGGCCATTTACTTTCCGACGTACAGCCAC
CTGAAGAAGGACATGTTTGGCGAGTCGGCGACCAAGAAGCTCGGGGTGTTGCAGCTGCTGACGGCGGGTGCCATG
GCGGGCATGCCTGCTGCTTACCTGACGACACCCTGCGATGTGATCAAGACGCGATTGCAGGTGGAGGCTCGCAAG
GGAGAGGCGTCGTACACGGGTCTGCGGCACGCGGCCAAGACCATCTGGCGCGAGGAGGGCTTCCGGGCCTTTTTC
CGGGGCGGACCGGCGCGCATCTTCCGGTCGTCGCCGCAGTTCGGCTTCACGCTGGCGGCGTACGAGGTGCTGCAG
AACATGGTACCCATGCCGGGAACGGCCAAGACGGAGGTGCGGATGCAGCAGGCGACGGCGACGGCGACGGGGGCC
GAGGGGGACATGACGCCTTGGGGACGCAGCCGGAACGCGCTCAAGATGATCCTCGACCTGGATGAGGACTTTGGC
ATGGCGAAGCTGCCGGATGAAAAGGGGTGGCGGTCTTTGCCGCGCTTCATGGGGGGCGGGGGCGGACAGGCTCAG
GGATAG
Gene >Ophcf2|04848
ATGGCCAAGGCCACAGCTGTCAGGGCGGCGGTCAAGGAGACGCTGCTGGGCTCGGGCGAGGAGCCGCCGCAGCTT
TCGGCTCAGAGTCGGGCGCGCTTTGTTGCCTGCGCGGTTAAGGATGCCGATACCGACGAGTTATACATGGGGCCT
GATGAGTTTATCAATGCTGTGGCGCCCAAGGATGAGGACTACGTGAGTTCGAGAGCCTATGATGAGGTGGATGCA
GAATGGGAGAGAAAGAGACGGGGAAAGACAAAGAGACGAGGCGAGGCGGAGCAACGGGACGGCTGACACGGCTTC
TTCTCCGCGCCTCAGCATAAGATCAGGCGCGAACAGTACTCGATTCTCTTTCGTGTCGCCGACAGCAGAGGCATT
GGCAGGGTCTCCATGTCCGACTGGAGCGTCTTCGAGAACCTCCTGATGAAGCCCGACGCCGAATACGAAATCGCA
TTCCGGCTCTTCGACGTCGACCGCACCGGCACCGTCAAGCACCAGGACGTCCGTCGGTTGTACGAGCTTAACAAG
GGTCCCGATCATCTCCCCTTCGACTGGGACTGCGAGTGGGCGCGCCTGCACATGGGCAGCAAGAAGAATCGACAC
GAGCTCGGCTATCCGCAGTTCTCGCAGATGCTGCGCGGCCTTCAGGGGGAGCGCATTCGTCAGGCTTTTCAGCTG
CTCGACCGAGATGGTGACGGCTACATCACCCCAGACGAGTTTGAGCGCATCATCCGCGAGACGTCGCGCCATAAG
CTGTCGGATCATCTGCTCGAGAACTTGCATACGCTCTGCAACATCGCGGTCGGCACCAAGATCTCGTACGCCAAC
GTGCGTGCCTTTCAGAACGTCATGCAGCAGGTGGACCATGTCGAGCGCATCATCCGCAGTGCCGTCGCTCGCAGC
GCCGATGGCAAGATTACACGCGCCGAGTTTGTCCGGGAGGCCGCACGCGTCACCCGCTTCTCCCTCTTCACCCCG
ATGGAGGCCGACATCCTGTTTCATTTTGCCAGCCTGGATGAGCCGTCGGGTCGGCTGGGGCTGGGAGACTTTGCC
AAGGTGCTGGACCCATCTTGGAAGAGCCGGGCGTACGAGAGCGAATACCATTCATCCCTCTCCTCGTCCGGGACG
GGGTCGACGGCGCTGCGCAAGGCGGCCGAGTCGACGTACAACTTTGCGCTGGGAAGTCTGGCTGGCGCGTTTGGC
GCCTTTATGGTGTATCCGATCGACCTGGTCAAGACGCGGCTGCAGAACCAGCGAGGCGCGCTGCCGGGTCAGCGG
CTGTACAAGAACTCGATCGACTGCTTCCAAAAGGTGTTTCGAAACGAGGGCATCCGCGGTCTTTACTCCGGCGTG
CTGCCGCAGCTGGTGGGCGTGGCGCCGGAGAAGGCCATCAAGTTGACGGTCAACGACCTGGTCCGAGGATACCTG
ACGGACCAGGAGGGCAAGATTCCGTGGTGGTCCGAGGTGGCGGCGGGTGCGAGTGCCGGAGGGTGCCAGGTGGTG
GGTGTTTTGGTTCCCTGGGCGCTTCCTGTTTCTTATGAGTGAAAGAGACCGACTGACGGGGCGGCGGCAGATCTT
TACCAACCCCCTCGAAATCGTCAAGATCCGGCTTCAGGTGCAGGGCGAGGTGGCCAAGACGGTCAACGCGACGCC
CAAGCGATCGGCCATGTGGATCGTGCGCAACCTGGGTCTGGTCGGGCTGTACAAGGGGGCGTCGGCGTGTCTGTT
GCGCGACGTGCCCTTCTCGGCCATTTACTTTCCGACGTACAGCCACCTGAAGAAGGACATGTTTGGCGAGTCGGC
GACCAAGAAGCTCGGGGTGTTGCAGCTGCTGACGGCGGGTGCCATGGCGGGCATGCCTGCTGCTTACCTGACGAC
ACCCTGCGATGTGATCAAGACGCGATTGCAGGTGGAGGCTCGCAAGGGAGAGGCGTCGTACACGGGTCTGCGGCA
CGCGGCCAAGACCATCTGGCGCGAGGAGGGCTTCCGGGCCTTTTTCCGGGGCGGACCGGCGCGCATCTTCCGGTC
GTCGCCGCAGTTCGGCTTCACGCTGGCGGCGTACGAGGTGCTGCAGAACATGGTACCCATGCCGGGAACGGCCAA
GACGGAGGTGCGGATGCAGCAGGCGACGGCGACGGCGACGGGGGCCGAGGGGGACATGACGCCTTGGGGACGCAG
CCGGAACGCGCTCAAGATGATCCTCGACCTGGATGAGGACTTTGGCATGGCGAAGCTGCCGGATGAAAAGGGGTG
GCGGTCTTTGCCGCGCTTCATGGGGGGCGGGGGCGGACAGGCTCAGGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail