Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04847
Gene name
Locationscaffold_05:1766950..1767959
Strand-
Gene length (bp)1009
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.1E-08 16 74
PF04193 PQ-loop PQ loop repeat 1.1E-14 183 235

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 97 119 22
4 131 153 22
5 173 195 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04847
MEMASDGPDGFLRGVSGLFGWVYTGAWSASFYAQPVLNFRRGATSGSTVDFPFLNVLGFAAYLASNTALYYSPLI
RAQYSARNHGTTPTVQFNDLSFALHALVLSSLTTSQYLLRRIWGFAPASGTRPSRFVVGIAGGCLVALLFTYVRV
VTDEGFRGGEGGPRWLFADADPAAVGWCELDLVYAAGYVKLVITLVKYTPQIIANARNRSTAGWSIWQILLDVVG
GVLSVAQQALDSYILRDWSGITGNPVKFALGNASLLYDSVFIAQHYVLYPEGDKRDERDPLLGEGGDDEESLRRR
RRLD*
Coding >Ophcf2|04847
ATGGAGATGGCGAGCGATGGCCCTGATGGCTTCCTGCGAGGGGTCTCGGGCCTGTTCGGATGGGTTTATACGGGG
GCTTGGAGCGCTTCCTTCTATGCGCAGCCCGTGCTCAACTTTCGGAGGGGGGCTACTTCCGGGTCGACGGTTGAC
TTTCCTTTCCTCAATGTTTTGGGCTTCGCGGCATATCTCGCCTCCAACACAGCCCTCTACTACTCCCCCCTGATC
CGCGCCCAATACTCAGCCCGCAACCACGGCACCACGCCAACCGTCCAATTCAACGACCTGAGCTTCGCCCTCCAC
GCCCTCGTCCTCTCCTCCCTCACAACATCGCAGTACCTCCTCCGCCGAATCTGGGGTTTCGCCCCCGCGTCGGGG
ACGAGGCCCTCTCGCTTCGTCGTCGGGATCGCGGGCGGTTGCCTCGTGGCCCTGCTGTTCACGTACGTGCGCGTC
GTCACGGACGAGGGTTTCCGGGGAGGAGAGGGGGGCCCGCGGTGGTTATTCGCTGATGCGGATCCTGCGGCCGTG
GGGTGGTGCGAGCTTGATCTCGTTTATGCGGCTGGCTATGTGAAGCTGGTCATCACGCTGGTAAAGTACACGCCG
CAGATTATAGCCAACGCTCGGAATCGAAGCACGGCCGGTTGGAGCATCTGGCAGATTCTGCTTGATGTCGTGGGC
GGGGTGCTGAGCGTGGCCCAGCAGGCGCTTGATAGTTATATCCTGCGCGACTGGTCGGGCATCACGGGCAATCCT
GTCAAGTTTGCGTTGGGGAACGCGAGCCTGCTGTATGATTCTGTCTTTATCGCTCAGCATTATGTGCTGTATCCC
GAGGGGGACAAGAGGGATGAGAGGGATCCTTTATTGGGGGAAGGGGGGGATGATGAGGAGAGTTTGAGGCGGAGG
AGGAGGTTGGATTGA
Transcript >Ophcf2|04847
ATGGAGATGGCGAGCGATGGCCCTGATGGCTTCCTGCGAGGGGTCTCGGGCCTGTTCGGATGGGTTTATACGGGG
GCTTGGAGCGCTTCCTTCTATGCGCAGCCCGTGCTCAACTTTCGGAGGGGGGCTACTTCCGGGTCGACGGTTGAC
TTTCCTTTCCTCAATGTTTTGGGCTTCGCGGCATATCTCGCCTCCAACACAGCCCTCTACTACTCCCCCCTGATC
CGCGCCCAATACTCAGCCCGCAACCACGGCACCACGCCAACCGTCCAATTCAACGACCTGAGCTTCGCCCTCCAC
GCCCTCGTCCTCTCCTCCCTCACAACATCGCAGTACCTCCTCCGCCGAATCTGGGGTTTCGCCCCCGCGTCGGGG
ACGAGGCCCTCTCGCTTCGTCGTCGGGATCGCGGGCGGTTGCCTCGTGGCCCTGCTGTTCACGTACGTGCGCGTC
GTCACGGACGAGGGTTTCCGGGGAGGAGAGGGGGGCCCGCGGTGGTTATTCGCTGATGCGGATCCTGCGGCCGTG
GGGTGGTGCGAGCTTGATCTCGTTTATGCGGCTGGCTATGTGAAGCTGGTCATCACGCTGGTAAAGTACACGCCG
CAGATTATAGCCAACGCTCGGAATCGAAGCACGGCCGGTTGGAGCATCTGGCAGATTCTGCTTGATGTCGTGGGC
GGGGTGCTGAGCGTGGCCCAGCAGGCGCTTGATAGTTATATCCTGCGCGACTGGTCGGGCATCACGGGCAATCCT
GTCAAGTTTGCGTTGGGGAACGCGAGCCTGCTGTATGATTCTGTCTTTATCGCTCAGCATTATGTGCTGTATCCC
GAGGGGGACAAGAGGGATGAGAGGGATCCTTTATTGGGGGAAGGGGGGGATGATGAGGAGAGTTTGAGGCGGAGG
AGGAGGTTGGATTGA
Gene >Ophcf2|04847
ATGGAGATGGCGAGCGATGGCCCTGATGGCTTCCTGCGAGGGGTCTCGGGCCTGTTCGGATGGGTTTATACGGGG
GCTTGGAGCGCTTCCTTCTATGCGCAGCCCGTGCTCAACTTTCGGAGGGGGGCTACTTCCGGGTCGACGGTTGAC
TTTCCTTTCCTCAATGTTTTGGGTGGGTGGAAGGATTCGTCCAGACGGCCAGAAAATGGGAGGAAAACAATGGCT
AACCGAGTGGTGATGATGTTGCCGTCTTACGATACGAATAGGCTTCGCGGCATATCTCGCCTCCAACACAGCCCT
CTACTACTCCCCCCTGATCCGCGCCCAATACTCAGCCCGCAACCACGGCACCACGCCAACCGTCCAATTCAACGA
CCTGAGCTTCGCCCTCCACGCCCTCGTCCTCTCCTCCCTCACAACATCGCAGTACCTCCTCCGCCGAATCTGGGG
TTTCGCCCCCGCGTCGGGGACGAGGCCCTCTCGCTTCGTCGTCGGGATCGCGGGCGGTTGCCTCGTGGCCCTGCT
GTTCACGTACGTGCGCGTCGTCACGGACGAGGGTTTCCGGGGAGGAGAGGGGGGCCCGCGGTGGTTATTCGCTGA
TGCGGATCCTGCGGCCGTGGGGTGGTGCGAGCTTGATCTCGTTTATGCGGCTGGCTATGTGAAGCTGGTCATCAC
GCTGGTAAAGTACACGCCGCAGATTATAGCCAACGCTCGGAATCGAAGCACGGCCGGTTGGAGCATCTGGCAGAT
TCTGCTTGATGTCGTGGGCGGGGTGCTGAGCGTGGCCCAGCAGGCGCTTGATAGTTATATCCTGCGCGACTGGTC
GGGCATCACGGGCAATCCTGTCAAGTTTGCGTTGGGGAACGCGAGCCTGCTGTATGATTCTGTCTTTATCGCTCA
GCATTATGTGCTGTATCCCGAGGGGGACAAGAGGGATGAGAGGGATCCTTTATTGGGGGAAGGGGGGGATGATGA
GGAGAGTTTGAGGCGGAGGAGGAGGTTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail