Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04845
Gene name
Locationscaffold_05:1761300..1763340
Strand-
Gene length (bp)2040
Transcript length (bp)2040
Coding sequence length (bp)2040
Protein length (aa) 680

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02219 MTHFR Methylenetetrahydrofolate reductase 5.1E-98 15 319

GO

GO Term Description Terminal node
GO:0004489 methylenetetrahydrofolate reductase (NAD(P)H) activity Yes
GO:0006555 methionine metabolic process Yes
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0019752 carboxylic acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006520 cellular amino acid metabolic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000096 sulfur amino acid metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0009066 aspartate family amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5843 0.4217 0.0372 0.0371 0.1799 0.0038 0.1319 0.4361 0.1982 0.0484

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup503
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1626
Ophiocordyceps australis 1348a (Ghana) OphauG2|6038
Ophiocordyceps australis map64 (Brazil) OphauB2|5839
Ophiocordyceps camponoti-floridani Ophcf2|04845 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5393
Ophiocordyceps kimflemingae Ophio5|8357
Ophiocordyceps subramaniannii Hirsu2|1555
Ophiocordyceps subramaniannii Hirsu2|5579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04845
MAVDKITHKIAALPDGVDYFSLEFFPPKTAMGFANLRHRLQRMEQALRPLFVNVTWGAGGATAIKSLELAELCQR
ELGLTTCLHLTCTNMSRRLIDKTLEDAKVLGIRNILALRGDAPRKEEYREAMADDYDQDDDDSVDFAWAIDLVRY
IRSKHGDYFCIGVAAYPEGHAVGSHPEVQSLEYDLPYLVDKVRAGADFIMTQLFFDADAYEKFERTLRDHPSGVF
ATLPIIPGLMPIQSYQMIKRTTKLSHARMPDAFTARLDEVKGDDERVKKIGVDIICELIEQIRAMGSGSPGRRGF
HFYTLNLEKSVSLIVEQTGLIQEDSSDEAVSDALLSPPPTLHVNGYGPLRPGGGHSRSSRRQSSVGSDPHNRVIV
GDRPLTNPEWETTGQEAGVPASSVNSRANTLAISEGEGVLGREATWDDFPNGRFGDARSPAYGEIDGYGVSLHMS
VTQAERLWGHPTTREDIDGIFVRHIRGELAAIPWSEEGLMAESSTIKDQLVELNSRGWWTVASQPAANGAPSSDR
TLGWGPTNGFVFQKAFVELFLPGSEWRTLWERLQRPGTRDSICFYAANARGDFASSDESGGAKDAGSAPSTNAVT
WGVFPGKEIVTPTIIEEVSFRAWSEEAFGIWREWARVYGMGSASEKLLRGIGDDYWLVNVIHHEFVETDALWDLL
LGRE*
Coding >Ophcf2|04845
ATGGCCGTCGATAAAATCACACACAAGATCGCCGCTCTTCCCGACGGCGTCGACTACTTCTCCCTCGAGTTCTTC
CCCCCAAAGACGGCCATGGGCTTCGCCAACCTGCGGCATCGGCTTCAGAGAATGGAGCAGGCCCTGCGGCCTTTG
TTCGTCAACGTCACCTGGGGAGCCGGAGGCGCCACGGCCATCAAGTCCCTCGAGCTGGCCGAACTCTGCCAGCGC
GAACTCGGCCTCACCACCTGTCTGCACCTCACCTGCACCAACATGAGTCGTCGGCTGATCGATAAGACGCTCGAG
GACGCCAAGGTGCTCGGTATCCGCAACATACTCGCCCTGAGAGGTGATGCTCCCCGCAAGGAAGAGTATCGCGAG
GCAATGGCCGACGACTACGATCAAGACGACGACGACTCGGTCGACTTTGCATGGGCCATTGATCTGGTTCGCTAC
ATTCGGAGCAAGCACGGTGACTACTTTTGCATCGGCGTCGCCGCCTATCCCGAGGGCCACGCCGTCGGCTCGCAC
CCTGAGGTTCAGAGCCTCGAGTATGATCTCCCCTACCTGGTCGACAAGGTCCGAGCCGGAGCCGATTTTATCATG
ACGCAACTCTTCTTCGACGCCGATGCGTACGAAAAGTTTGAGCGCACTCTCCGAGACCACCCGAGCGGCGTCTTT
GCCACCCTTCCCATCATACCCGGCCTGATGCCCATACAGAGCTATCAGATGATCAAGCGCACCACCAAGCTCAGC
CACGCGAGGATGCCCGACGCTTTCACGGCTCGTCTCGACGAGGTCAAGGGAGACGACGAGCGAGTAAAGAAGATT
GGCGTCGACATCATCTGCGAGCTCATCGAGCAGATCAGGGCCATGGGGAGCGGCAGTCCGGGCCGCCGGGGATTT
CACTTTTACACGCTCAACCTGGAGAAGTCGGTGTCGCTCATCGTCGAGCAGACGGGTCTGATTCAGGAGGATTCA
TCGGACGAGGCCGTCTCGGACGCCCTCCTTTCGCCACCGCCGACGCTTCACGTCAACGGCTACGGGCCCCTGCGA
CCGGGAGGCGGCCATTCGCGCTCGTCTCGGCGACAGTCGTCGGTCGGATCGGATCCTCACAACCGCGTCATCGTC
GGCGACCGGCCACTGACGAATCCGGAGTGGGAGACTACGGGTCAGGAAGCCGGGGTTCCGGCGAGCAGCGTCAAC
TCGAGAGCCAACACGCTGGCCATTTCCGAGGGCGAAGGCGTGCTCGGACGCGAGGCCACCTGGGATGACTTTCCC
AACGGCCGGTTCGGTGATGCCCGGTCACCGGCGTACGGCGAGATTGACGGTTACGGCGTGAGCCTTCACATGTCG
GTGACGCAGGCCGAGCGGCTCTGGGGCCATCCGACGACGCGCGAGGACATTGATGGCATCTTTGTCCGGCACATC
CGTGGCGAGCTGGCGGCCATCCCCTGGAGCGAGGAGGGACTGATGGCGGAGTCGTCGACCATCAAAGATCAACTG
GTGGAGCTCAACAGCCGGGGCTGGTGGACGGTGGCGTCTCAGCCGGCAGCCAACGGGGCGCCATCGAGTGACAGG
ACGTTGGGCTGGGGTCCGACCAACGGCTTCGTCTTCCAAAAGGCGTTTGTCGAGTTGTTCCTACCGGGCTCGGAG
TGGCGGACGCTATGGGAACGGCTGCAACGGCCGGGGACGCGCGACTCCATCTGCTTCTACGCGGCCAACGCTCGG
GGGGACTTTGCGTCGTCGGACGAGAGCGGAGGGGCCAAAGACGCTGGCTCGGCGCCGAGCACCAACGCCGTCACG
TGGGGCGTCTTCCCGGGCAAGGAGATTGTGACGCCGACGATTATCGAGGAGGTGAGCTTCCGGGCCTGGAGCGAG
GAGGCGTTTGGTATCTGGAGGGAGTGGGCTCGGGTTTACGGGATGGGGTCTGCGAGCGAGAAGCTGCTGAGGGGG
ATCGGGGATGATTACTGGTTGGTTAACGTCATTCATCACGAGTTTGTTGAGACGGATGCGTTGTGGGATCTGTTG
TTGGGGCGGGAGTAG
Transcript >Ophcf2|04845
ATGGCCGTCGATAAAATCACACACAAGATCGCCGCTCTTCCCGACGGCGTCGACTACTTCTCCCTCGAGTTCTTC
CCCCCAAAGACGGCCATGGGCTTCGCCAACCTGCGGCATCGGCTTCAGAGAATGGAGCAGGCCCTGCGGCCTTTG
TTCGTCAACGTCACCTGGGGAGCCGGAGGCGCCACGGCCATCAAGTCCCTCGAGCTGGCCGAACTCTGCCAGCGC
GAACTCGGCCTCACCACCTGTCTGCACCTCACCTGCACCAACATGAGTCGTCGGCTGATCGATAAGACGCTCGAG
GACGCCAAGGTGCTCGGTATCCGCAACATACTCGCCCTGAGAGGTGATGCTCCCCGCAAGGAAGAGTATCGCGAG
GCAATGGCCGACGACTACGATCAAGACGACGACGACTCGGTCGACTTTGCATGGGCCATTGATCTGGTTCGCTAC
ATTCGGAGCAAGCACGGTGACTACTTTTGCATCGGCGTCGCCGCCTATCCCGAGGGCCACGCCGTCGGCTCGCAC
CCTGAGGTTCAGAGCCTCGAGTATGATCTCCCCTACCTGGTCGACAAGGTCCGAGCCGGAGCCGATTTTATCATG
ACGCAACTCTTCTTCGACGCCGATGCGTACGAAAAGTTTGAGCGCACTCTCCGAGACCACCCGAGCGGCGTCTTT
GCCACCCTTCCCATCATACCCGGCCTGATGCCCATACAGAGCTATCAGATGATCAAGCGCACCACCAAGCTCAGC
CACGCGAGGATGCCCGACGCTTTCACGGCTCGTCTCGACGAGGTCAAGGGAGACGACGAGCGAGTAAAGAAGATT
GGCGTCGACATCATCTGCGAGCTCATCGAGCAGATCAGGGCCATGGGGAGCGGCAGTCCGGGCCGCCGGGGATTT
CACTTTTACACGCTCAACCTGGAGAAGTCGGTGTCGCTCATCGTCGAGCAGACGGGTCTGATTCAGGAGGATTCA
TCGGACGAGGCCGTCTCGGACGCCCTCCTTTCGCCACCGCCGACGCTTCACGTCAACGGCTACGGGCCCCTGCGA
CCGGGAGGCGGCCATTCGCGCTCGTCTCGGCGACAGTCGTCGGTCGGATCGGATCCTCACAACCGCGTCATCGTC
GGCGACCGGCCACTGACGAATCCGGAGTGGGAGACTACGGGTCAGGAAGCCGGGGTTCCGGCGAGCAGCGTCAAC
TCGAGAGCCAACACGCTGGCCATTTCCGAGGGCGAAGGCGTGCTCGGACGCGAGGCCACCTGGGATGACTTTCCC
AACGGCCGGTTCGGTGATGCCCGGTCACCGGCGTACGGCGAGATTGACGGTTACGGCGTGAGCCTTCACATGTCG
GTGACGCAGGCCGAGCGGCTCTGGGGCCATCCGACGACGCGCGAGGACATTGATGGCATCTTTGTCCGGCACATC
CGTGGCGAGCTGGCGGCCATCCCCTGGAGCGAGGAGGGACTGATGGCGGAGTCGTCGACCATCAAAGATCAACTG
GTGGAGCTCAACAGCCGGGGCTGGTGGACGGTGGCGTCTCAGCCGGCAGCCAACGGGGCGCCATCGAGTGACAGG
ACGTTGGGCTGGGGTCCGACCAACGGCTTCGTCTTCCAAAAGGCGTTTGTCGAGTTGTTCCTACCGGGCTCGGAG
TGGCGGACGCTATGGGAACGGCTGCAACGGCCGGGGACGCGCGACTCCATCTGCTTCTACGCGGCCAACGCTCGG
GGGGACTTTGCGTCGTCGGACGAGAGCGGAGGGGCCAAAGACGCTGGCTCGGCGCCGAGCACCAACGCCGTCACG
TGGGGCGTCTTCCCGGGCAAGGAGATTGTGACGCCGACGATTATCGAGGAGGTGAGCTTCCGGGCCTGGAGCGAG
GAGGCGTTTGGTATCTGGAGGGAGTGGGCTCGGGTTTACGGGATGGGGTCTGCGAGCGAGAAGCTGCTGAGGGGG
ATCGGGGATGATTACTGGTTGGTTAACGTCATTCATCACGAGTTTGTTGAGACGGATGCGTTGTGGGATCTGTTG
TTGGGGCGGGAGTAG
Gene >Ophcf2|04845
ATGGCCGTCGATAAAATCACACACAAGATCGCCGCTCTTCCCGACGGCGTCGACTACTTCTCCCTCGAGTTCTTC
CCCCCAAAGACGGCCATGGGCTTCGCCAACCTGCGGCATCGGCTTCAGAGAATGGAGCAGGCCCTGCGGCCTTTG
TTCGTCAACGTCACCTGGGGAGCCGGAGGCGCCACGGCCATCAAGTCCCTCGAGCTGGCCGAACTCTGCCAGCGC
GAACTCGGCCTCACCACCTGTCTGCACCTCACCTGCACCAACATGAGTCGTCGGCTGATCGATAAGACGCTCGAG
GACGCCAAGGTGCTCGGTATCCGCAACATACTCGCCCTGAGAGGTGATGCTCCCCGCAAGGAAGAGTATCGCGAG
GCAATGGCCGACGACTACGATCAAGACGACGACGACTCGGTCGACTTTGCATGGGCCATTGATCTGGTTCGCTAC
ATTCGGAGCAAGCACGGTGACTACTTTTGCATCGGCGTCGCCGCCTATCCCGAGGGCCACGCCGTCGGCTCGCAC
CCTGAGGTTCAGAGCCTCGAGTATGATCTCCCCTACCTGGTCGACAAGGTCCGAGCCGGAGCCGATTTTATCATG
ACGCAACTCTTCTTCGACGCCGATGCGTACGAAAAGTTTGAGCGCACTCTCCGAGACCACCCGAGCGGCGTCTTT
GCCACCCTTCCCATCATACCCGGCCTGATGCCCATACAGAGCTATCAGATGATCAAGCGCACCACCAAGCTCAGC
CACGCGAGGATGCCCGACGCTTTCACGGCTCGTCTCGACGAGGTCAAGGGAGACGACGAGCGAGTAAAGAAGATT
GGCGTCGACATCATCTGCGAGCTCATCGAGCAGATCAGGGCCATGGGGAGCGGCAGTCCGGGCCGCCGGGGATTT
CACTTTTACACGCTCAACCTGGAGAAGTCGGTGTCGCTCATCGTCGAGCAGACGGGTCTGATTCAGGAGGATTCA
TCGGACGAGGCCGTCTCGGACGCCCTCCTTTCGCCACCGCCGACGCTTCACGTCAACGGCTACGGGCCCCTGCGA
CCGGGAGGCGGCCATTCGCGCTCGTCTCGGCGACAGTCGTCGGTCGGATCGGATCCTCACAACCGCGTCATCGTC
GGCGACCGGCCACTGACGAATCCGGAGTGGGAGACTACGGGTCAGGAAGCCGGGGTTCCGGCGAGCAGCGTCAAC
TCGAGAGCCAACACGCTGGCCATTTCCGAGGGCGAAGGCGTGCTCGGACGCGAGGCCACCTGGGATGACTTTCCC
AACGGCCGGTTCGGTGATGCCCGGTCACCGGCGTACGGCGAGATTGACGGTTACGGCGTGAGCCTTCACATGTCG
GTGACGCAGGCCGAGCGGCTCTGGGGCCATCCGACGACGCGCGAGGACATTGATGGCATCTTTGTCCGGCACATC
CGTGGCGAGCTGGCGGCCATCCCCTGGAGCGAGGAGGGACTGATGGCGGAGTCGTCGACCATCAAAGATCAACTG
GTGGAGCTCAACAGCCGGGGCTGGTGGACGGTGGCGTCTCAGCCGGCAGCCAACGGGGCGCCATCGAGTGACAGG
ACGTTGGGCTGGGGTCCGACCAACGGCTTCGTCTTCCAAAAGGCGTTTGTCGAGTTGTTCCTACCGGGCTCGGAG
TGGCGGACGCTATGGGAACGGCTGCAACGGCCGGGGACGCGCGACTCCATCTGCTTCTACGCGGCCAACGCTCGG
GGGGACTTTGCGTCGTCGGACGAGAGCGGAGGGGCCAAAGACGCTGGCTCGGCGCCGAGCACCAACGCCGTCACG
TGGGGCGTCTTCCCGGGCAAGGAGATTGTGACGCCGACGATTATCGAGGAGGTGAGCTTCCGGGCCTGGAGCGAG
GAGGCGTTTGGTATCTGGAGGGAGTGGGCTCGGGTTTACGGGATGGGGTCTGCGAGCGAGAAGCTGCTGAGGGGG
ATCGGGGATGATTACTGGTTGGTTAACGTCATTCATCACGAGTTTGTTGAGACGGATGCGTTGTGGGATCTGTTG
TTGGGGCGGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail