Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04843
Gene name
Locationscaffold_05:1757601..1758584
Strand+
Gene length (bp)983
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.2E-11 157 214

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 38 60 22
3 70 88 18
4 131 153 22
5 158 180 22
6 187 209 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 35.54 16.95 54.13
Alive In ants, during behavior modification 159.49 89.22 229.76
Dead In ants, recently dead 90.76 50.26 131.27

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04843
MSGWLAACAGYVAPLFIVLSPILSYGDQAMSMHRAKSSAGFSLDIPLIMLVASFFRIFYWHGARFDTSLLLQSLI
MVGMQVVLLKIALDNRPGPSSKGGESSMPFQQENLLSVQRPFDFWQWRSPKPYWQFLVYLVCVLMAFEVVLAAMP
PVYALWSATLGYVGLSVEATLAIPQILANSQARSCKGFRLSVLIAWLGGDALKILWFFTSTTDIPVAFKVCGIFQ
AACDCLLGAQYMQYGDGERRITDHPLEEGRWSSAVMVPERPHSRSFSQTKTGVIYSDAEVD*
Coding >Ophcf2|04843
ATGAGCGGTTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCTTGTCGCCTATCCTCTCGTAC
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGCATCTTTTACTGGCACGGAGCCCGCTTCGATACCAGCCTGCTGCTGCAATCGCTCATC
ATGGTCGGCATGCAAGTCGTCCTGCTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAG
TCCAGCATGCCCTTTCAACAGGAGAACCTCCTGTCCGTCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCT
AAGCCATACTGGCAATTTCTCGTCTACCTCGTCTGCGTCCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCC
CCCGTCTACGCCCTCTGGTCAGCGACGCTAGGCTACGTAGGCCTCTCTGTCGAGGCGACGTTGGCCATCCCCCAG
ATCCTGGCCAACTCGCAGGCCCGCTCGTGCAAGGGCTTCCGGCTTTCCGTCCTGATCGCCTGGCTGGGCGGCGAT
GCCCTCAAGATTCTCTGGTTCTTCACCTCCACCACCGACATCCCCGTCGCCTTTAAAGTCTGCGGCATCTTCCAG
GCTGCCTGCGACTGCCTACTGGGCGCGCAGTACATGCAATACGGCGACGGAGAGCGCCGCATCACGGATCATCCG
CTCGAGGAGGGCCGCTGGTCCAGCGCCGTCATGGTGCCTGAGAGGCCTCACAGCCGGAGCTTTTCCCAGACCAAG
ACGGGCGTCATCTACTCGGATGCCGAGGTGGATTAG
Transcript >Ophcf2|04843
ATGAGCGGTTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCTTGTCGCCTATCCTCTCGTAC
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGCATCTTTTACTGGCACGGAGCCCGCTTCGATACCAGCCTGCTGCTGCAATCGCTCATC
ATGGTCGGCATGCAAGTCGTCCTGCTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAG
TCCAGCATGCCCTTTCAACAGGAGAACCTCCTGTCCGTCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCT
AAGCCATACTGGCAATTTCTCGTCTACCTCGTCTGCGTCCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCC
CCCGTCTACGCCCTCTGGTCAGCGACGCTAGGCTACGTAGGCCTCTCTGTCGAGGCGACGTTGGCCATCCCCCAG
ATCCTGGCCAACTCGCAGGCCCGCTCGTGCAAGGGCTTCCGGCTTTCCGTCCTGATCGCCTGGCTGGGCGGCGAT
GCCCTCAAGATTCTCTGGTTCTTCACCTCCACCACCGACATCCCCGTCGCCTTTAAAGTCTGCGGCATCTTCCAG
GCTGCCTGCGACTGCCTACTGGGCGCGCAGTACATGCAATACGGCGACGGAGAGCGCCGCATCACGGATCATCCG
CTCGAGGAGGGCCGCTGGTCCAGCGCCGTCATGGTGCCTGAGAGGCCTCACAGCCGGAGCTTTTCCCAGACCAAG
ACGGGCGTCATCTACTCGGATGCCGAGGTGGATTAG
Gene >Ophcf2|04843
ATGAGCGGTTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCTTGTCGCCTATCCTCTCGTAC
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGGTCCGTCTCTGCCTCGAGTCCGTGGGAGAAAGTCAGTGGGAGATGGTCATGCTGACTT
CTTACAGCATCTTTTACTGGCACGGAGCCCGCTTCGATACCAGCCTGCTGCTGCAATCGCTCATCATGGTCGGCA
TGCAAGTCGTCCTGCTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAGTCCAGCATGC
CCTTTCAACAGGAGAACCTCCTGTCCGTCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCTAAGCCGTGAG
TCTCTCCCTCGTCCATATTCCGGCTCGCTCATATCTCCAACTGCTACTCCAGATACTGGCAATTTCTCGTCTACC
TCGTCTGCGTCCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCCCCCGTCTACGCCCTCTGGTCAGCGACGC
TAGGCTACGTAGGCCTCTCTGTCGAGGCGACGTTGGCCATCCCCCAGATCCTGGCCAACTCGCAGGCCCGCTCGT
GCAAGGGCTTCCGGCTTTCCGTCCTGATCGCCTGGCTGGGCGGCGATGCCCTCAAGATTCTCTGGTTCTTCACCT
CCACCACCGACATCCCCGTCGCCTTTAAAGTCTGCGGCATCTTCCAGGCTGCCTGCGACTGCCTACTGGGCGCGC
AGTACATGCAATACGGCGACGGAGAGCGCCGCATCACGGATCATCCGCTCGAGGAGGGCCGCTGGTCCAGCGCCG
TCATGGTGCCTGAGAGGCCTCACAGCCGGAGCTTTTCCCAGACCAAGACGGGCGTCATCTACTCGGATGCCGAGG
TGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail