Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04830
Gene name
Locationscaffold_05:1725437..1726518
Strand-
Gene length (bp)1081
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 7.2E-66 49 301

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5719 0.2018 0.3214 0.0174 0.1889 0.0882 0.2342 0.3689 0.4581 0.0787

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup405
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6941
Ophiocordyceps australis map64 (Brazil) OphauB2|5850
Ophiocordyceps camponoti-floridani Ophcf2|04830 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5854
Ophiocordyceps kimflemingae Ophio5|5164
Ophiocordyceps kimflemingae Ophio5|682
Ophiocordyceps subramaniannii Hirsu2|2221
Ophiocordyceps subramaniannii Hirsu2|2825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04830
MATPYRFNISAADTGLLKIKQDDAAATRVTELLQQDLENHHVYFNDSGFHNHIAHQLLTLYGTGSTAQGLSQAYE
QNKSYQLPARKASTSTADSLSNWSANAGPLLGNDAHYADFLLYFQRAIDENGWQAVVASHLLGDSPACLDMLGRL
CAGFYHPAIQLMYGIEWEQPALVAEALAQAAVHDARVADLMSEVDEAAKLRDEVAVQSLPALLEGIREQQPKLAG
SARWEDPNRIFDGVLARARPEAVALLAGIRVRPEELEEKTAEMIHTAAYVAAAASWNPPYTPKYDFFLLHHLTAS
PSS*
Coding >Ophcf2|04830
ATGGCGACGCCCTACCGCTTCAACATCTCTGCTGCCGATACGGGCTTGCTCAAGATCAAACAGGACGATGCTGCT
GCTACGCGCGTGACGGAGCTGCTGCAGCAGGATCTCGAGAATCATCACGTCTACTTCAACGACTCGGGCTTCCAC
AACCACATCGCACACCAGCTCCTTACCCTCTACGGAACAGGCAGCACAGCCCAAGGCCTAAGCCAAGCCTACGAA
CAGAACAAATCCTACCAGCTCCCCGCCCGCAAAGCCTCGACCTCGACCGCCGACTCCCTGAGCAACTGGTCCGCC
AACGCAGGCCCCCTCCTCGGCAACGACGCCCACTACGCTGATTTCCTCCTCTACTTCCAGCGCGCCATCGATGAA
AACGGCTGGCAGGCTGTCGTCGCCAGTCATCTCCTCGGCGATTCCCCCGCCTGTCTCGACATGCTGGGCAGGCTA
TGCGCCGGCTTCTACCATCCGGCCATTCAGCTCATGTACGGCATCGAATGGGAGCAGCCAGCTCTCGTAGCCGAG
GCTCTCGCCCAGGCCGCCGTTCACGACGCCCGCGTTGCAGACTTGATGAGCGAGGTAGACGAGGCTGCCAAGCTG
AGAGATGAGGTAGCCGTCCAGTCTCTTCCCGCGCTGTTGGAGGGCATTCGCGAGCAGCAGCCCAAGTTGGCCGGC
AGTGCGCGCTGGGAGGATCCCAATCGAATCTTTGACGGTGTGCTGGCGAGGGCGAGGCCTGAGGCTGTGGCTTTG
CTTGCGGGTATTCGGGTTAGGCCTGAGGAGTTGGAGGAGAAGACGGCTGAGATGATTCATACGGCTGCCTATGTC
GCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCAAAATACGACTTCTTCCTCCTCCACCACCTGACCGCCTCC
CCCTCTTCCTAA
Transcript >Ophcf2|04830
ATGGCGACGCCCTACCGCTTCAACATCTCTGCTGCCGATACGGGCTTGCTCAAGATCAAACAGGACGATGCTGCT
GCTACGCGCGTGACGGAGCTGCTGCAGCAGGATCTCGAGAATCATCACGTCTACTTCAACGACTCGGGCTTCCAC
AACCACATCGCACACCAGCTCCTTACCCTCTACGGAACAGGCAGCACAGCCCAAGGCCTAAGCCAAGCCTACGAA
CAGAACAAATCCTACCAGCTCCCCGCCCGCAAAGCCTCGACCTCGACCGCCGACTCCCTGAGCAACTGGTCCGCC
AACGCAGGCCCCCTCCTCGGCAACGACGCCCACTACGCTGATTTCCTCCTCTACTTCCAGCGCGCCATCGATGAA
AACGGCTGGCAGGCTGTCGTCGCCAGTCATCTCCTCGGCGATTCCCCCGCCTGTCTCGACATGCTGGGCAGGCTA
TGCGCCGGCTTCTACCATCCGGCCATTCAGCTCATGTACGGCATCGAATGGGAGCAGCCAGCTCTCGTAGCCGAG
GCTCTCGCCCAGGCCGCCGTTCACGACGCCCGCGTTGCAGACTTGATGAGCGAGGTAGACGAGGCTGCCAAGCTG
AGAGATGAGGTAGCCGTCCAGTCTCTTCCCGCGCTGTTGGAGGGCATTCGCGAGCAGCAGCCCAAGTTGGCCGGC
AGTGCGCGCTGGGAGGATCCCAATCGAATCTTTGACGGTGTGCTGGCGAGGGCGAGGCCTGAGGCTGTGGCTTTG
CTTGCGGGTATTCGGGTTAGGCCTGAGGAGTTGGAGGAGAAGACGGCTGAGATGATTCATACGGCTGCCTATGTC
GCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCAAAATACGACTTCTTCCTCCTCCACCACCTGACCGCCTCC
CCCTCTTCCTAA
Gene >Ophcf2|04830
ATGGCGACGCCCTACCGCTTCAACATCTCTGCTGCCGATACGGGCTTGCTCAAGATCAAACAGGACGATGCTGCT
GCTACGCGCGTGACGGAGCTGCTGCAGCAGGATCTCGAGGTTAGGCATCGTCTTCAGACTGTTGCTCCGCTGCTT
ACCCTCAACCGTATCTTTTCAGAATCATCACGTCTACTTCAACGACTCGGGCTTCCACAACCACGTACTTCTAGA
ACCCCATCCCCTCGCCCCTTGGAATCAACGTCTAACACCATCCAGATCGCACACCAGCTCCTTACCCTCTACGGA
ACAGGCAGCACAGCCCAAGGCCTAAGCCAAGCCTACGAACAGAACAAATCCTACCAGCTCCCCGCCCGCAAAGCC
TCGACCTCGACCGCCGACTCCCTGAGCAACTGGTCCGCCAACGCAGGCCCCCTCCTCGGCAACGACGCCCACTAC
GCTGATTTCCTCCTCTACTTCCAGCGCGCCATCGATGAAAACGGCTGGCAGGCTGTCGTCGCCAGTCATCTCCTC
GGCGATTCCCCCGCCTGTCTCGACATGCTGGGCAGGCTATGCGCCGGCTTCTACCATCCGGCCATTCAGCTCATG
TACGGCATCGAATGGGAGCAGCCAGCTCTCGTAGCCGAGGCTCTCGCCCAGGCCGCCGTTCACGACGCCCGCGTT
GCAGACTTGATGAGCGAGGTAGACGAGGCTGCCAAGCTGAGAGATGAGGTAGCCGTCCAGTCTCTTCCCGCGCTG
TTGGAGGGCATTCGCGAGCAGCAGCCCAAGTTGGCCGGCAGTGCGCGCTGGGAGGATCCCAATCGAATCTTTGAC
GGTGTGCTGGCGAGGGCGAGGCCTGAGGCTGTGGCTTTGCTTGCGGGTATTCGGGTTAGGCCTGAGGAGTTGGAG
GAGAAGACGGCTGAGATGATTCATACGGCTGCCTATGTCGCTGCCGCTGCGTCTTGGAACCCGCCTTACACGCCA
AAATACGACTTCTTCCTCCTGTATGAACCCCTTCCCCCCTATCAAGCAAGATACCCATCTAACCCCCCCCCATAG
CCACCACCTGACCGCCTCCCCCTCTTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail