Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04825
Gene name
Locationscaffold_05:1709058..1710372
Strand+
Gene length (bp)1314
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00710 Asparaginase Asparaginase, N-terminal 1.7E-58 24 244
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 4.6E-26 264 381

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.562 0.4326 0.0379 0.1642 0.2118 0.033 0.1579 0.1116 0.1023 0.1339

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6716
Ophiocordyceps australis map64 (Brazil) OphauB2|7368
Ophiocordyceps camponoti-floridani Ophcf2|04825 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5847
Ophiocordyceps kimflemingae Ophio5|2821
Ophiocordyceps subramaniannii Hirsu2|5215

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04825
MAPSQVDAAPDMDEETPAALPESRVLIIGTGGTICMTQGPDGLAPSVGFLERAMAPRPSFNDRSGLHEPVKLQAV
RNGIPINLPSLRTPPTAHKRHIRYSVLEYDPLVDSSCISASDWSAMATTIRENYHLFDGFVILHGTDSLAYTASA
LSFTFANLGKPVILTGSQSPIFDLQSDAVDNLLGSLIIAGTYVIPEVGLFFHHKLHRGNRTTKISAASFDAFASP
NCDPLALVNGLGIQVNWPLVLRPTSIAEFKVESPLDTTHVACLRVFPGIRPEMVDSVLRLPHLRGLILETFGMGN
VPGGADGLLTSAIASAVARGVVVVNVSQCVSGFASPVYAPGTLLSRAGVIFGLDMTAEAALAKLSYLLARNDDPP
QISRLFSRSLRGELTEPTLPTFTHPAPIPSPPPQPV*
Coding >Ophcf2|04825
ATGGCTCCCTCCCAGGTCGACGCCGCCCCTGACATGGACGAAGAAACCCCCGCCGCCCTTCCCGAGTCCCGCGTC
CTCATCATCGGTACCGGCGGCACCATCTGCATGACACAGGGACCCGACGGCTTGGCCCCGAGCGTAGGCTTCCTC
GAGCGAGCAATGGCTCCGCGGCCGAGCTTCAACGACAGGTCCGGGCTGCACGAACCAGTCAAGCTCCAAGCCGTC
CGCAACGGCATCCCCATCAACCTCCCCTCCCTCCGAACCCCTCCGACCGCCCACAAGCGACACATCCGCTATTCA
GTCCTCGAATACGACCCCCTCGTCGACTCGTCCTGCATCAGCGCATCCGACTGGTCAGCCATGGCCACGACGATT
CGCGAAAACTACCACCTCTTCGACGGCTTCGTCATCCTCCACGGCACCGACTCCCTCGCCTACACAGCCTCAGCT
CTCTCCTTCACCTTTGCCAACCTCGGCAAGCCCGTCATCCTAACAGGCTCCCAATCTCCCATCTTCGACCTCCAG
TCCGACGCCGTAGACAACCTCCTGGGCTCGCTCATCATCGCAGGGACATACGTCATCCCCGAAGTCGGCCTCTTC
TTCCATCATAAACTCCACCGCGGAAACAGAACGACAAAGATATCAGCCGCCTCGTTCGACGCCTTCGCCAGCCCC
AATTGCGACCCTCTCGCCCTCGTCAACGGCCTCGGCATCCAGGTCAACTGGCCGCTCGTCCTACGGCCCACGTCC
ATCGCGGAATTCAAGGTCGAGAGCCCCCTCGACACAACGCACGTCGCCTGTCTACGCGTCTTCCCCGGCATCCGC
CCGGAGATGGTCGACTCGGTCCTCCGCCTCCCTCACCTCCGAGGCCTCATCCTCGAAACCTTTGGCATGGGCAAC
GTCCCCGGCGGCGCAGACGGTCTCCTCACATCGGCCATAGCCTCGGCCGTCGCCCGCGGCGTCGTCGTCGTAAAC
GTCAGCCAATGCGTCAGCGGATTCGCCTCCCCCGTATACGCACCAGGGACCCTCCTCAGCCGCGCCGGCGTCATC
TTCGGCCTCGACATGACGGCCGAAGCCGCCCTCGCCAAACTATCATACCTCCTCGCCCGCAACGATGACCCCCCC
CAGATATCCCGCCTCTTCAGCCGCTCCCTCCGAGGCGAACTGACGGAACCCACCCTCCCAACCTTCACCCATCCA
GCCCCCATCCCCTCGCCGCCGCCGCAACCCGTCTAA
Transcript >Ophcf2|04825
ATGGCTCCCTCCCAGGTCGACGCCGCCCCTGACATGGACGAAGAAACCCCCGCCGCCCTTCCCGAGTCCCGCGTC
CTCATCATCGGTACCGGCGGCACCATCTGCATGACACAGGGACCCGACGGCTTGGCCCCGAGCGTAGGCTTCCTC
GAGCGAGCAATGGCTCCGCGGCCGAGCTTCAACGACAGGTCCGGGCTGCACGAACCAGTCAAGCTCCAAGCCGTC
CGCAACGGCATCCCCATCAACCTCCCCTCCCTCCGAACCCCTCCGACCGCCCACAAGCGACACATCCGCTATTCA
GTCCTCGAATACGACCCCCTCGTCGACTCGTCCTGCATCAGCGCATCCGACTGGTCAGCCATGGCCACGACGATT
CGCGAAAACTACCACCTCTTCGACGGCTTCGTCATCCTCCACGGCACCGACTCCCTCGCCTACACAGCCTCAGCT
CTCTCCTTCACCTTTGCCAACCTCGGCAAGCCCGTCATCCTAACAGGCTCCCAATCTCCCATCTTCGACCTCCAG
TCCGACGCCGTAGACAACCTCCTGGGCTCGCTCATCATCGCAGGGACATACGTCATCCCCGAAGTCGGCCTCTTC
TTCCATCATAAACTCCACCGCGGAAACAGAACGACAAAGATATCAGCCGCCTCGTTCGACGCCTTCGCCAGCCCC
AATTGCGACCCTCTCGCCCTCGTCAACGGCCTCGGCATCCAGGTCAACTGGCCGCTCGTCCTACGGCCCACGTCC
ATCGCGGAATTCAAGGTCGAGAGCCCCCTCGACACAACGCACGTCGCCTGTCTACGCGTCTTCCCCGGCATCCGC
CCGGAGATGGTCGACTCGGTCCTCCGCCTCCCTCACCTCCGAGGCCTCATCCTCGAAACCTTTGGCATGGGCAAC
GTCCCCGGCGGCGCAGACGGTCTCCTCACATCGGCCATAGCCTCGGCCGTCGCCCGCGGCGTCGTCGTCGTAAAC
GTCAGCCAATGCGTCAGCGGATTCGCCTCCCCCGTATACGCACCAGGGACCCTCCTCAGCCGCGCCGGCGTCATC
TTCGGCCTCGACATGACGGCCGAAGCCGCCCTCGCCAAACTATCATACCTCCTCGCCCGCAACGATGACCCCCCC
CAGATATCCCGCCTCTTCAGCCGCTCCCTCCGAGGCGAACTGACGGAACCCACCCTCCCAACCTTCACCCATCCA
GCCCCCATCCCCTCGCCGCCGCCGCAACCCGTCTAA
Gene >Ophcf2|04825
ATGGCTCCCTCCCAGGTCGACGCCGCCCCTGACATGGACGAAGAAACCCCCGCCGCCCTTCCCGAGTCCCGCGTC
CTCATCATCGGTACCGGCGGCACCATCTGCATGACACAGGGACCCGACGGCTTGGCCCCGAGCGTAGGCTTCCTC
GAGCGAGCAATGGCTCCGCGGCCGAGCTTCAACGACAGGTCCGGGCTGCACGGTAAGTGCCGACCCATCCCCCCC
CCCCCCCCCCGGAGAACATATCCGAGTATCCAGGTATTCATACGAGATACACAAGAACCAGTCAAGCTCCAAGCC
GTCCGCAACGGCATCCCCATCAACCTCCCCTCCCTCCGAACCCCTCCGACCGCCCACAAGCGACACATCCGCTAT
TCAGTCCTCGAATACGACCCCCTCGTCGACTCGTCCTGCATCAGCGCATCCGACTGGTCAGCCATGGCCACGACG
ATTCGCGAAAACTACCACCTCTTCGACGGCTTCGTCATCCTCCACGGCACCGACTCCCTCGCCTACACAGCCTCA
GCTCTCTCCTTCACCTTTGCCAACCTCGGCAAGCCCGTCATCCTAACAGGCTCCCAATCTCCCATCTTCGACCTC
CAGTCCGACGCCGTAGACAACCTCCTGGGCTCGCTCATCATCGCAGGGACATACGTCATCCCCGAAGTCGGCCTC
TTCTTCCATCATAAACTCCACCGCGGAAACAGAACGACAAAGATATCAGCCGCCTCGTTCGACGCCTTCGCCAGC
CCCAATTGCGACCCTCTCGCCCTCGTCAACGGCCTCGGCATCCAGGTCAACTGGCCGCTCGTCCTACGGCCCACG
TCCATCGCGGAATTCAAGGTCGAGAGCCCCCTCGACACAACGCACGTCGCCTGTCTACGCGTCTTCCCCGGCATC
CGCCCGGAGATGGTCGACTCGGTCCTCCGCCTCCCTCACCTCCGAGGCCTCATCCTCGAAACCTTTGGCATGGGC
AACGTCCCCGGCGGCGCAGACGGTCTCCTCACATCGGCCATAGCCTCGGCCGTCGCCCGCGGCGTCGTCGTCGTA
AACGTCAGCCAATGCGTCAGCGGATTCGCCTCCCCCGTATACGCACCAGGGACCCTCCTCAGCCGCGCCGGCGTC
ATCTTCGGCCTCGACATGACGGCCGAAGCCGCCCTCGCCAAACTATCATACCTCCTCGCCCGCAACGATGACCCC
CCCCAGATATCCCGCCTCTTCAGCCGCTCCCTCCGAGGCGAACTGACGGAACCCACCCTCCCAACCTTCACCCAT
CCAGCCCCCATCCCCTCGCCGCCGCCGCAACCCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail