Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04823
Gene name
Locationscaffold_05:1705098..1705725
Strand+
Gene length (bp)627
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 81 103 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 61.03 27.80 94.26
Alive In ants, during behavior modification 80.06 38.70 121.42
Dead In ants, recently dead 83.23 40.37 126.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.257984 no
Alive Dead 0.878413 no
Dead Fungus 0.192121 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04823
MDDANPNPLLAALAFVVRIRWASHLIRIVRLIFLPVRLAIAGLSRIASVLAVVFAPAVYIFALCLWLSKAVVALI
LGLEPLYKFFSVAVTIGITSGIILALTSSLITNLLGMQDDPDVSDRQQKLQLEPSPAVPPSWESDWFWAESSSPQ
AKRRQPSGLLSQTIHEEDSDI*
Coding >Ophcf2|04823
ATGGACGACGCCAATCCAAATCCCCTCCTCGCCGCCCTCGCCTTCGTCGTCCGTATCCGCTGGGCCTCGCACCTT
ATTCGTATCGTTCGCCTCATCTTCCTGCCCGTTCGCCTTGCTATCGCGGGTCTCTCTCGCATCGCCTCCGTTCTC
GCCGTCGTCTTCGCCCCGGCCGTGTACATATTTGCTCTCTGTCTGTGGCTGTCCAAGGCTGTCGTTGCCTTGATC
CTTGGCTTAGAGCCCTTGTATAAATTTTTCAGCGTTGCCGTTACCATCGGCATCACCTCAGGCATCATTCTTGCA
CTCACATCCTCCCTCATCACAAACTTGCTCGGCATGCAAGACGATCCAGACGTCTCAGATCGTCAGCAGAAGCTT
CAGCTGGAGCCTTCGCCGGCGGTACCGCCCTCGTGGGAATCCGACTGGTTTTGGGCCGAGTCCTCCTCGCCTCAG
GCCAAACGTCGGCAGCCTTCTGGCCTCCTATCTCAGACCATTCACGAAGAGGACTCGGACATATAG
Transcript >Ophcf2|04823
ATGGACGACGCCAATCCAAATCCCCTCCTCGCCGCCCTCGCCTTCGTCGTCCGTATCCGCTGGGCCTCGCACCTT
ATTCGTATCGTTCGCCTCATCTTCCTGCCCGTTCGCCTTGCTATCGCGGGTCTCTCTCGCATCGCCTCCGTTCTC
GCCGTCGTCTTCGCCCCGGCCGTGTACATATTTGCTCTCTGTCTGTGGCTGTCCAAGGCTGTCGTTGCCTTGATC
CTTGGCTTAGAGCCCTTGTATAAATTTTTCAGCGTTGCCGTTACCATCGGCATCACCTCAGGCATCATTCTTGCA
CTCACATCCTCCCTCATCACAAACTTGCTCGGCATGCAAGACGATCCAGACGTCTCAGATCGTCAGCAGAAGCTT
CAGCTGGAGCCTTCGCCGGCGGTACCGCCCTCGTGGGAATCCGACTGGTTTTGGGCCGAGTCCTCCTCGCCTCAG
GCCAAACGTCGGCAGCCTTCTGGCCTCCTATCTCAGACCATTCACGAAGAGGACTCGGACATATAG
Gene >Ophcf2|04823
ATGGACGACGCCAATCCAAATCCCCTCCTCGCCGCCCTCGCCTTCGTCGTCCGTATCCGCTGGGCCTCGCACCTT
ATTCGTATCGTTCGCCTCATCTTCCTGCCCGTTCGCCTTGCTATCGCGGGTCTCTCTCGCATCGCCTCCGTTCTC
GCCGTCGTCTTCGCCCCGGCCGTGTACATATTTGCTCTCTGTCTGTGGCTGTCCAAGGCTGTCGTTGCCTTGATC
CTTGGCTTAGAGGTCCGTCTCTAGGTATCAGAACCGGATGAGCATTCGCTGACTTTCTCGCTCATCAGCCCTTGT
ATAAATTTGTGAGCGTTTCTGGTTCCGTCCCTCCCTTCTTCCCTCGACTTACTCTCCTCCCAGTTCAGCGTTGCC
GTTACCATCGGCATCACCTCAGGCATCATTCTTGCACTCACATCCTCCCTCATCACAAACTTGCTCGGCATGCAA
GACGATCCAGACGTCTCAGATCGTCAGCAGAAGCTTCAGCTGGAGCCTTCGCCGGCGGTACCGCCCTCGTGGGAA
TCCGACTGGTTTTGGGCCGAGTCCTCCTCGCCTCAGGCCAAACGTCGGCAGCCTTCTGGCCTCCTATCTCAGACC
ATTCACGAAGAGGACTCGGACATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail