Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04818
Gene name
Locationscaffold_05:1695990..1697120
Strand-
Gene length (bp)1130
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 4.8E-07 239 264
PF13499 EF-hand_7 EF-hand domain pair 7.9E-14 195 263
PF13202 EF-hand_5 EF hand 2.5E-04 129 151
PF13202 EF-hand_5 EF hand 2.8E-02 201 218
PF13202 EF-hand_5 EF hand 3.3E-06 240 263
PF13833 EF-hand_8 EF-hand domain pair 3.0E-04 173 219
PF13833 EF-hand_8 EF-hand domain pair 5.2E-05 225 264

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.526 0.4806 0.1493 0.2612 0.1517 0.3413 0.31 0.2711 0.1731 0.1428

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2826
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1713
Ophiocordyceps australis map64 (Brazil) OphauB2|7359
Ophiocordyceps camponoti-floridani Ophcf2|04818 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6188
Ophiocordyceps kimflemingae Ophio5|2828
Ophiocordyceps subramaniannii Hirsu2|458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04818
MGNGGRQVHLKRLLRLAAAASSTRLSLTTRDGISESREGGPCVCGDDVSVISVAGDFRPFLEKSRSAISLIAATP
LQPRLPRVRQKPDPLRHTRLSPLWRTAVMGNTTSAVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIERDEFL
SLPQISSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLQFAFKVYDIDRDGYISNGELFIVLKMM
VGNNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSMTLDQF*
Coding >Ophcf2|04818
ATGGGCAATGGAGGCCGGCAGGTGCACTTGAAGCGCCTCCTCCGCCTCGCTGCAGCGGCCTCATCGACTCGCCTC
AGCCTGACGACTCGTGACGGTATCAGTGAGTCGCGAGAAGGTGGCCCGTGCGTCTGCGGCGACGACGTCTCTGTC
ATCTCTGTTGCCGGCGATTTCCGCCCGTTCTTGGAGAAAAGCCGCAGCGCCATCAGCCTCATCGCCGCCACTCCG
CTTCAGCCTCGTCTGCCGCGCGTTCGTCAGAAGCCGGACCCTCTACGCCATACCCGTCTCTCGCCGCTTTGGCGG
ACGGCCGTCATGGGCAACACCACCAGCGCTGTCCTGGACAACATCGTCCAGGGCTCCAACTTTGACAGAGAAGAA
GTCGATCGGCTGCGCAAGCGTTTTATGAAGCTCGATAAGGACAACTCAGGTACCATCGAGCGAGACGAATTCCTC
AGCCTGCCGCAAATCTCGTCTAATCCTCTAGCCACACGCATGATTGCCATCTTCGACGAGGACGGCGGTGGCGAC
GTCGACTTCCAGGAGTTTGTCTCGGGCCTGAGCGCCTTTAGCAGCAAGGGCAATAAAGAGCAGAAGCTGCAGTTT
GCATTCAAGGTCTACGATATTGACCGCGACGGCTACATAAGCAACGGCGAGCTGTTCATTGTGCTCAAGATGATG
GTAGGTAACAACCTCAAGGACCAGCAGCTTCAGCAGATTGTCGACAAGACCATCATGGAGGCCGACCTCGATAAG
GACGGCAAGATAAGCTTCGAAGAATTTACCAAGATGGTAGAGAATACGGACGTGAGCATGAGCATGACACTTGAC
CAGTTTTGA
Transcript >Ophcf2|04818
ATGGGCAATGGAGGCCGGCAGGTGCACTTGAAGCGCCTCCTCCGCCTCGCTGCAGCGGCCTCATCGACTCGCCTC
AGCCTGACGACTCGTGACGGTATCAGTGAGTCGCGAGAAGGTGGCCCGTGCGTCTGCGGCGACGACGTCTCTGTC
ATCTCTGTTGCCGGCGATTTCCGCCCGTTCTTGGAGAAAAGCCGCAGCGCCATCAGCCTCATCGCCGCCACTCCG
CTTCAGCCTCGTCTGCCGCGCGTTCGTCAGAAGCCGGACCCTCTACGCCATACCCGTCTCTCGCCGCTTTGGCGG
ACGGCCGTCATGGGCAACACCACCAGCGCTGTCCTGGACAACATCGTCCAGGGCTCCAACTTTGACAGAGAAGAA
GTCGATCGGCTGCGCAAGCGTTTTATGAAGCTCGATAAGGACAACTCAGGTACCATCGAGCGAGACGAATTCCTC
AGCCTGCCGCAAATCTCGTCTAATCCTCTAGCCACACGCATGATTGCCATCTTCGACGAGGACGGCGGTGGCGAC
GTCGACTTCCAGGAGTTTGTCTCGGGCCTGAGCGCCTTTAGCAGCAAGGGCAATAAAGAGCAGAAGCTGCAGTTT
GCATTCAAGGTCTACGATATTGACCGCGACGGCTACATAAGCAACGGCGAGCTGTTCATTGTGCTCAAGATGATG
GTAGGTAACAACCTCAAGGACCAGCAGCTTCAGCAGATTGTCGACAAGACCATCATGGAGGCCGACCTCGATAAG
GACGGCAAGATAAGCTTCGAAGAATTTACCAAGATGGTAGAGAATACGGACGTGAGCATGAGCATGACACTTGAC
CAGTTTTGA
Gene >Ophcf2|04818
ATGGGCAATGGAGGCCGGCAGGTGCACTTGAAGCGCCTCCTCCGCCTCGCTGCAGCGGTTCGTCCATTTCACAGC
AACTGACTCGAGCCAAGTGCCTTTCTATCTTATCTAGGCCTCATCGACTCGCCTCAGCCTGACGACTCGTGACGG
TATCAGTGAGTCGCGAGAAGGTGGCCCGTGCGTCTGCGGCGACGACGTCTCTGTCATCTCTGTTGCCGGCGATTT
CCGCCCGTTCTTGGAGAAAAGCCGCAGCGCCATCAGCCTCATCGCCGCCACTCCGCTTCAGCCTCGTCTGCCGCG
CGTTCGTCAGAAGCCGGACCCTCTACGCCATACCCGTCTCTCGCCGCTTTGGCGGACGGCCGTCATGGGCAACAC
CACCAGCGCTGTCCTGGACAACATCGTCCAGGGCTCCAACTGTGCGGCGATCTGCCCCGGGCTCCGTGGGAAGAC
TGGAAAGCGGCAGCTGCTGACTCCCCGCCAGTTGACAGAGAAGAAGTCGATCGGCTGCGCAAGCGTTTTATGAAG
CTCGATAAGGTGTGTCGGCTCTTCCCCCGTCTCCCATCCTTCCCCCCGCGATGCCCCGCTGAAGCCGTCGGGTCA
GGACAACTCAGGTACCATCGAGCGAGACGAATTCCTCAGCCTGCCGCAAATCTCGTCTAATCCTCTAGCCACACG
GTTCGCGCGCCACCCCCTTCGGATGGTGATCGGGGCTGACTTTGGGCGCAGCATGATTGCCATCTTCGACGAGGA
CGGCGGTGGCGACGTCGACTTCCAGGAGTTTGTCTCGGGCCTGAGCGCCTTTAGCAGCAAGGGCAATAAAGAGCA
GAAGCTGCAGTTTGCATTCAAGGTCTACGATATTGACCGCGACGGCTACATAAGCAACGGCGAGCTGTTCATTGT
GCTCAAGATGATGGTAGGTAACAACCTCAAGGACCAGCAGCTTCAGCAGATTGTCGACAAGACCATCATGGAGGC
CGACCTCGATAAGGACGGCAAGATAAGCTTCGAAGAATTTACCAAGATGGTAGAGAATACGGACGTGAGCATGAG
CATGACACTTGGTAAGTCGCTCTTGTCTTGTGGGGTGGAAGATTTGATGGCTAACGAAAGGGTTCATAGACCAGT
TTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail