Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04817
Gene name
Locationscaffold_05:1692995..1694483
Strand-
Gene length (bp)1488
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 3.4E-61 36 490
PF01266 DAO FAD dependent oxidoreductase 1.6E-11 28 362
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 6.2E-11 31 93
PF01494 FAD_binding_3 FAD binding domain 2.4E-06 27 60
PF00890 FAD_binding_2 FAD binding domain 9.9E-06 28 68

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.106 0.0512 0.9072 0.0608 0.1484 0.045 0.2184 0.3662 0.1001 0.0165

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup566
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7932
Ophiocordyceps camponoti-floridani Ophcf2|04817 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6189
Ophiocordyceps kimflemingae Ophio5|2829
Ophiocordyceps subramaniannii Hirsu2|5171
Ophiocordyceps subramaniannii Hirsu2|5172
Ophiocordyceps subramaniannii Hirsu2|7748

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04817
MRPSTTALTTLLLTLVGASNKTKTKHVDVVIVGAGLSGLSTARRLAEAGVTFTVLEARSRVGGRTVNARVNESPS
GAQEMGAEYVGPTQDRVLELARWLAIETYKTFDQGNTTVWRNGTLTTFHGDEASGGLLPLTPEAQGEVLPLVEEM
ATMAANLTVGRAWEHPRAAEWDSMTCASFVRDRVSNPDARFVFDIIFDAVLSVETHEPSLLYWLSYISSAGNETQ
PGTLARLLQTGNGAQESRVVGGTQQLSIRLAERLGLHNILFNSPVHSIVRRRQARKRGSRSYHVHYGNGRVIMAD
HVVVAMSPPLAGRITYEPPMPAKRDQLTQRMPMSTIAKMVAVYPKPFWRDQGLNGQVLSDEGVTRATFDNSPDDG
SYGALMGFIGGNQDRQMNLLDESEVRRLVTKDLVRYFGPQAAYSTGFYLQRWDLEPYSRGGPVAYAPPGVLTEYG
SALRQPVGDIHFAGTESSDYWVGYMDGALRSGERVAKEILDRLKG*
Coding >Ophcf2|04817
ATGAGGCCAAGCACGACGGCTCTCACGACGCTGCTGTTGACCTTGGTCGGGGCATCCAACAAGACCAAAACCAAG
CATGTCGACGTGGTCATCGTCGGGGCCGGCCTCAGCGGTCTTTCGACGGCCCGGAGGCTGGCCGAGGCGGGAGTG
ACCTTTACCGTGCTCGAGGCTCGATCGCGGGTCGGCGGACGGACAGTCAATGCGCGGGTGAACGAGTCGCCGAGC
GGAGCGCAAGAGATGGGCGCCGAATACGTCGGACCGACGCAGGATCGCGTTCTGGAGCTGGCACGATGGTTGGCC
ATCGAGACGTACAAGACCTTTGACCAGGGGAACACGACCGTCTGGCGTAACGGGACGCTGACGACCTTTCATGGT
GATGAGGCTTCGGGGGGGTTGCTGCCGCTCACGCCCGAGGCTCAGGGGGAGGTGCTGCCTCTGGTGGAGGAGATG
GCGACCATGGCGGCCAATCTGACGGTCGGGAGAGCTTGGGAGCATCCTCGGGCGGCGGAATGGGACAGCATGACG
TGTGCGAGTTTCGTCAGGGATCGCGTCAGTAATCCGGATGCTAGATTCGTCTTCGACATCATCTTCGATGCTGTG
CTTTCCGTCGAGACGCACGAGCCGTCGCTTCTATACTGGTTGTCGTATATTTCCAGCGCCGGCAACGAGACGCAG
CCCGGGACCTTGGCCAGACTGCTTCAGACGGGCAATGGAGCGCAGGAGAGTCGTGTCGTTGGAGGAACGCAGCAG
CTTTCCATCAGGTTGGCCGAGAGACTCGGCCTACACAACATCCTCTTCAACTCGCCTGTTCACAGCATCGTCAGG
CGCAGACAAGCGAGGAAAAGGGGGAGTCGCTCGTACCATGTTCACTATGGCAATGGGAGGGTCATCATGGCGGAT
CATGTCGTTGTTGCCATGTCGCCTCCGCTCGCGGGCAGGATCACCTACGAGCCTCCCATGCCGGCCAAGAGAGAT
CAGCTCACGCAGCGGATGCCCATGAGCACCATCGCCAAGATGGTTGCTGTTTATCCGAAGCCGTTTTGGAGGGAT
CAGGGGTTGAACGGACAGGTTCTTAGCGATGAGGGGGTTACGCGAGCTACCTTTGATAACTCGCCTGACGATGGC
TCTTACGGGGCGCTGATGGGCTTCATCGGGGGCAATCAGGATCGTCAGATGAATCTCCTGGATGAGTCCGAGGTC
CGTCGGCTCGTCACCAAGGATCTGGTCAGGTACTTTGGACCGCAGGCGGCGTACTCGACCGGCTTCTATCTTCAG
CGGTGGGATCTGGAGCCGTATTCGCGGGGGGGCCCCGTCGCCTATGCTCCCCCGGGGGTGTTGACCGAGTATGGG
TCCGCCTTGAGGCAGCCTGTCGGCGATATTCACTTCGCCGGCACGGAGAGTTCGGATTATTGGGTTGGGTATATG
GATGGGGCTTTGAGGTCGGGCGAGAGGGTGGCTAAGGAGATTTTGGATAGGTTGAAGGGGTGA
Transcript >Ophcf2|04817
ATGAGGCCAAGCACGACGGCTCTCACGACGCTGCTGTTGACCTTGGTCGGGGCATCCAACAAGACCAAAACCAAG
CATGTCGACGTGGTCATCGTCGGGGCCGGCCTCAGCGGTCTTTCGACGGCCCGGAGGCTGGCCGAGGCGGGAGTG
ACCTTTACCGTGCTCGAGGCTCGATCGCGGGTCGGCGGACGGACAGTCAATGCGCGGGTGAACGAGTCGCCGAGC
GGAGCGCAAGAGATGGGCGCCGAATACGTCGGACCGACGCAGGATCGCGTTCTGGAGCTGGCACGATGGTTGGCC
ATCGAGACGTACAAGACCTTTGACCAGGGGAACACGACCGTCTGGCGTAACGGGACGCTGACGACCTTTCATGGT
GATGAGGCTTCGGGGGGGTTGCTGCCGCTCACGCCCGAGGCTCAGGGGGAGGTGCTGCCTCTGGTGGAGGAGATG
GCGACCATGGCGGCCAATCTGACGGTCGGGAGAGCTTGGGAGCATCCTCGGGCGGCGGAATGGGACAGCATGACG
TGTGCGAGTTTCGTCAGGGATCGCGTCAGTAATCCGGATGCTAGATTCGTCTTCGACATCATCTTCGATGCTGTG
CTTTCCGTCGAGACGCACGAGCCGTCGCTTCTATACTGGTTGTCGTATATTTCCAGCGCCGGCAACGAGACGCAG
CCCGGGACCTTGGCCAGACTGCTTCAGACGGGCAATGGAGCGCAGGAGAGTCGTGTCGTTGGAGGAACGCAGCAG
CTTTCCATCAGGTTGGCCGAGAGACTCGGCCTACACAACATCCTCTTCAACTCGCCTGTTCACAGCATCGTCAGG
CGCAGACAAGCGAGGAAAAGGGGGAGTCGCTCGTACCATGTTCACTATGGCAATGGGAGGGTCATCATGGCGGAT
CATGTCGTTGTTGCCATGTCGCCTCCGCTCGCGGGCAGGATCACCTACGAGCCTCCCATGCCGGCCAAGAGAGAT
CAGCTCACGCAGCGGATGCCCATGAGCACCATCGCCAAGATGGTTGCTGTTTATCCGAAGCCGTTTTGGAGGGAT
CAGGGGTTGAACGGACAGGTTCTTAGCGATGAGGGGGTTACGCGAGCTACCTTTGATAACTCGCCTGACGATGGC
TCTTACGGGGCGCTGATGGGCTTCATCGGGGGCAATCAGGATCGTCAGATGAATCTCCTGGATGAGTCCGAGGTC
CGTCGGCTCGTCACCAAGGATCTGGTCAGGTACTTTGGACCGCAGGCGGCGTACTCGACCGGCTTCTATCTTCAG
CGGTGGGATCTGGAGCCGTATTCGCGGGGGGGCCCCGTCGCCTATGCTCCCCCGGGGGTGTTGACCGAGTATGGG
TCCGCCTTGAGGCAGCCTGTCGGCGATATTCACTTCGCCGGCACGGAGAGTTCGGATTATTGGGTTGGGTATATG
GATGGGGCTTTGAGGTCGGGCGAGAGGGTGGCTAAGGAGATTTTGGATAGGTTGAAGGGGTGA
Gene >Ophcf2|04817
ATGAGGCCAAGCACGACGGCTCTCACGACGCTGCTGTTGACCTTGGTCGGGGCATCCAACAAGACCAAAACCAAG
CATGTCGACGTGGTCATCGTCGGGGCCGGCCTCAGCGGTCTTTCGACGGCCCGGAGGCTGGCCGAGGCGGGAGTG
ACCTTTACCGTGCTCGAGGCTCGATCGCGGGTCGGCGGACGGACAGTCAATGCGCGGGTGAACGAGTCGCCGAGC
GGAGCGCAAGAGATGGGCGCCGAATACGTCGGACCGACGCAGGATCGCGTTCTGGAGCTGGCACGATGGTTGGCC
ATCGAGACGTACAAGACCTTTGACCAGGGGAACACGACCGTCTGGCGTAACGGGACGCTGACGACCTTTCATGGT
GATGAGGCTTCGGGGGGGTTGCTGCCGCTCACGCCCGAGGCTCAGGGGGAGGTGCTGCCTCTGGTGGAGGAGATG
GCGACCATGGCGGCCAATCTGACGGTCGGGAGAGCTTGGGAGCATCCTCGGGCGGCGGAATGGGACAGCATGACG
TGTGCGAGTTTCGTCAGGGATCGCGTCAGTAATCCGGATGCTAGATTCGTCTTCGACATCATCTTCGATGCTGTG
CTTTCCGTCGAGACGCACGAGCCGTCGCTTCTATACTGGTTGTCGTATATTTCCAGCGCCGGCAACGAGACGCAG
CCCGGGACCTTGGCCAGACTGCTTCAGACGGGCAATGGAGCGCAGGAGAGTCGTGTCGTTGGAGGAACGCAGCAG
CTTTCCATCAGGTTGGCCGAGAGACTCGGCCTACACAACATCCTCTTCAACTCGCCTGTTCACAGCATCGTCAGG
CGCAGACAAGCGAGGAAAAGGGGGAGTCGCTCGTACCATGTTCACTATGGCAATGGGAGGGTCATCATGGCGGAT
CATGTCGTTGTTGCCATGTCGCCTCCGCTCGCGGGCAGGATCACCTACGAGCCTCCCATGCCGGCCAAGAGAGAT
CAGCTCACGCAGCGGATGCCCATGAGCACCATCGCCAAGATGGTTGCTGTTTATCCGAAGCCGTTTTGGAGGGAT
CAGGGGTTGAACGGACAGGTTCTTAGCGATGAGGGGGTTACGCGAGCTACCTTTGATAACTCGCCTGACGATGGC
TCTTACGGGGCGCTGATGGGCTTCATCGGGGGCAATCAGGATCGTCAGATGAATCTCCTGGATGAGTCCGAGGTC
CGTCGGCTCGTCACCAAGGATCTGGTCAGGTACTTTGGACCGCAGGCGGCGTACTCGACCGGCTTCTATCTTCAG
CGGTGGGATCTGGAGCCGTATTCGCGGGGGGGCCCCGTCGCCTATGCTCCCCCGGGGGTGTTGACCGAGTATGGG
TCCGCCTTGAGGCAGCCTGTCGGCGATATTCACTTCGCCGGCACGGAGAGTTCGGATTATTGGGTTGGGTATATG
GATGGGGCTTTGAGGTCGGGCGAGAGGGTGGCTAAGGAGATTTTGGATAGGTTGAAGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail