Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04814
Gene name
Locationscaffold_05:1686918..1687869
Strand+
Gene length (bp)951
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2148 0.1243 0.776 0.1112 0.1586 0.0558 0.3006 0.3181 0.2256 0.0069

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999655

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup65
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7300
Ophiocordyceps australis map64 (Brazil) OphauB2|4715
Ophiocordyceps camponoti-floridani Ophcf2|02168
Ophiocordyceps camponoti-floridani Ophcf2|04814 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06000
Ophiocordyceps camponoti-rufipedis Ophun1|1467
Ophiocordyceps camponoti-rufipedis Ophun1|169
Ophiocordyceps camponoti-rufipedis Ophun1|6192
Ophiocordyceps kimflemingae Ophio5|2277
Ophiocordyceps kimflemingae Ophio5|3034
Ophiocordyceps kimflemingae Ophio5|960
Ophiocordyceps subramaniannii Hirsu2|10179
Ophiocordyceps subramaniannii Hirsu2|1104
Ophiocordyceps subramaniannii Hirsu2|457
Ophiocordyceps subramaniannii Hirsu2|4942
Ophiocordyceps subramaniannii Hirsu2|7062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04814
MHLATGLLLPFVFFSPALSDSEFPNVSRCFDNGPFLFSTAFGDFLSNGSACTAMVPGREVLECAVETIPRQLRPL
TSPLTDTIKAWEWHYNSDINTVYRGADNDSPGEQGRDSDNVWEALLSYWRLRKTLCWHYRNPFHMDHIMPSNAGF
LSLFHANDDLQQPILKTKSHWHYRGPTVCTLADDGSKDRDRRTRAVKSMVRRSMYWGDGGTELQNGHLHYQQVYS
TDPFLQAVITGWQSARLPSCPQHHRCEGHLLPEKAFLPLNGDDFLIKIKFALETDKNVCVVVPGSDPSVEGAYLV
LSPILYGGQRKVSKET*
Coding >Ophcf2|04814
ATGCACCTCGCAACCGGCCTCCTCCTCCCCTTCGTCTTCTTCTCCCCAGCCCTCTCAGACTCCGAATTCCCCAAT
GTCTCCCGCTGCTTCGACAACGGCCCATTCCTCTTCTCAACCGCCTTCGGAGACTTCCTCTCCAACGGCTCAGCC
TGCACAGCCATGGTCCCCGGCCGCGAAGTCCTGGAATGCGCAGTCGAAACGATCCCCAGGCAGCTCCGGCCCCTC
ACGTCCCCCCTGACGGACACGATCAAGGCGTGGGAATGGCACTACAACTCGGATATCAATACCGTCTATCGCGGT
GCAGATAATGACTCACCCGGGGAGCAGGGCCGTGACTCTGACAACGTGTGGGAGGCGTTGCTTTCGTATTGGAGA
CTGAGGAAGACGCTGTGCTGGCACTATAGAAACCCCTTTCATATGGATCACATCATGCCCTCCAACGCCGGATTC
CTAAGCCTCTTCCACGCCAACGATGATCTACAGCAACCGATACTCAAGACCAAGAGTCACTGGCACTACCGCGGC
CCAACCGTCTGCACCCTAGCAGATGACGGCAGCAAGGACAGAGACCGCCGGACTCGAGCAGTCAAGTCCATGGTA
AGACGAAGCATGTACTGGGGAGATGGAGGCACGGAGCTGCAAAACGGCCATCTTCACTACCAGCAAGTCTACTCG
ACCGACCCCTTCCTCCAGGCCGTCATCACCGGCTGGCAGTCAGCACGGCTACCGTCCTGTCCGCAACACCACCGG
TGCGAGGGTCATCTGCTGCCGGAGAAGGCGTTTCTGCCGCTGAACGGGGATGATTTCCTCATCAAGATCAAGTTT
GCGCTTGAGACGGATAAGAATGTTTGTGTTGTTGTGCCGGGATCGGATCCGTCGGTTGAGGGCGCCTATCTTGTC
CTATCACCCATTCTGTACGGGGGCCAGCGGAAGGTTTCGAAGGAGACGTGA
Transcript >Ophcf2|04814
ATGCACCTCGCAACCGGCCTCCTCCTCCCCTTCGTCTTCTTCTCCCCAGCCCTCTCAGACTCCGAATTCCCCAAT
GTCTCCCGCTGCTTCGACAACGGCCCATTCCTCTTCTCAACCGCCTTCGGAGACTTCCTCTCCAACGGCTCAGCC
TGCACAGCCATGGTCCCCGGCCGCGAAGTCCTGGAATGCGCAGTCGAAACGATCCCCAGGCAGCTCCGGCCCCTC
ACGTCCCCCCTGACGGACACGATCAAGGCGTGGGAATGGCACTACAACTCGGATATCAATACCGTCTATCGCGGT
GCAGATAATGACTCACCCGGGGAGCAGGGCCGTGACTCTGACAACGTGTGGGAGGCGTTGCTTTCGTATTGGAGA
CTGAGGAAGACGCTGTGCTGGCACTATAGAAACCCCTTTCATATGGATCACATCATGCCCTCCAACGCCGGATTC
CTAAGCCTCTTCCACGCCAACGATGATCTACAGCAACCGATACTCAAGACCAAGAGTCACTGGCACTACCGCGGC
CCAACCGTCTGCACCCTAGCAGATGACGGCAGCAAGGACAGAGACCGCCGGACTCGAGCAGTCAAGTCCATGGTA
AGACGAAGCATGTACTGGGGAGATGGAGGCACGGAGCTGCAAAACGGCCATCTTCACTACCAGCAAGTCTACTCG
ACCGACCCCTTCCTCCAGGCCGTCATCACCGGCTGGCAGTCAGCACGGCTACCGTCCTGTCCGCAACACCACCGG
TGCGAGGGTCATCTGCTGCCGGAGAAGGCGTTTCTGCCGCTGAACGGGGATGATTTCCTCATCAAGATCAAGTTT
GCGCTTGAGACGGATAAGAATGTTTGTGTTGTTGTGCCGGGATCGGATCCGTCGGTTGAGGGCGCCTATCTTGTC
CTATCACCCATTCTGTACGGGGGCCAGCGGAAGGTTTCGAAGGAGACGTGA
Gene >Ophcf2|04814
ATGCACCTCGCAACCGGCCTCCTCCTCCCCTTCGTCTTCTTCTCCCCAGCCCTCTCAGACTCCGAATTCCCCAAT
GTCTCCCGCTGCTTCGACAACGGCCCATTCCTCTTCTCAACCGCCTTCGGAGACTTCCTCTCCAACGGCTCAGCC
TGCACAGCCATGGTCCCCGGCCGCGAAGTCCTGGAATGCGCAGTCGAAACGATCCCCAGGCAGCTCCGGCCCCTC
ACGTCCCCCCTGACGGACACGATCAAGGCGTGGGAATGGCACTACAACTCGGATATCAATACCGTCTATCGCGGT
GCAGATAATGACTCACCCGGGGAGCAGGGCCGTGACTCTGACAACGTGTGGGAGGCGTTGCTTTCGTATTGGAGA
CTGAGGAAGACGCTGTGCTGGCACTATAGAAACCCCTTTCATATGGATCACATCATGCCCTCCAACGCCGGATTC
CTAAGCCTCTTCCACGCCAACGATGATCTACAGCAACCGATACTCAAGACCAAGAGTCACTGGCACTACCGCGGC
CCAACCGTCTGCACCCTAGCAGATGACGGCAGCAAGGACAGAGACCGCCGGACTCGAGCAGTCAAGTCCATGGTA
AGACGAAGCATGTACTGGGGAGATGGAGGCACGGAGCTGCAAAACGGCCATCTTCACTACCAGCAAGTCTACTCG
ACCGACCCCTTCCTCCAGGCCGTCATCACCGGCTGGCAGTCAGCACGGCTACCGTCCTGTCCGCAACACCACCGG
TGCGAGGGTCATCTGCTGCCGGAGAAGGCGTTTCTGCCGCTGAACGGGGATGATTTCCTCATCAAGATCAAGTTT
GCGCTTGAGACGGATAAGAATGTTTGTGTTGTTGTGCCGGGATCGGATCCGTCGGTTGAGGGCGCCTATCTTGTC
CTATCACCCATTCTGTACGGGGGCCAGCGGAAGGTTTCGAAGGAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail