Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04806
Gene name
Locationscaffold_05:1636972..1637763
Strand+
Gene length (bp)791
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 113 135 22
3 174 196 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.86 0.00 1.94
Alive In ants, during behavior modification 385.40 85.66 685.15
Dead In ants, recently dead 116.98 64.04 169.93

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04806
MSSLALLSLLQLVVAAVGVWSKLRSGFGLVEVPSPARLIEPGCWLEDLGGLIPFAIMVEMISPVRKLRAVSLLGL
LSAILGFAAAMPALSLWILQAAEHKALSRRQRSVLGKLAFLSAVTHVGAFVVALSTACLGLDSSPWHVMNSLLSG
PDHPGRLPEKALREARLRQINEMTGTSSGFFMAAGLLLLRLEIWLLDLRPEVRW*
Coding >Ophcf2|04806
ATGTCGTCGCTTGCTCTTCTGAGCCTCCTTCAGCTGGTGGTGGCGGCCGTCGGCGTCTGGAGCAAGCTGCGGTCT
GGCTTCGGGCTGGTAGAGGTGCCGAGTCCGGCTCGTCTGATTGAGCCCGGCTGTTGGCTCGAGGATCTTGGAGGG
CTCATCCCGTTTGCCATCATGGTGGAGATGATATCACCGGTCAGGAAGTTGAGAGCCGTCTCCTTACTGGGCTTG
CTATCGGCCATCTTGGGCTTCGCCGCCGCCATGCCGGCCCTCTCCCTGTGGATCCTGCAGGCAGCCGAGCACAAG
GCCCTCAGCCGGAGACAGAGGTCCGTCCTAGGCAAGCTAGCCTTCCTATCGGCTGTGACGCACGTGGGAGCCTTT
GTCGTGGCACTTTCCACGGCCTGTCTCGGCCTCGACTCCAGCCCCTGGCACGTCATGAACAGCCTGCTATCCGGC
CCGGACCACCCCGGCCGTCTCCCGGAAAAGGCCTTGCGGGAGGCCCGTCTGCGGCAGATCAACGAGATGACGGGC
ACGTCGAGCGGCTTCTTCATGGCGGCCGGCTTGCTGCTGCTCAGGCTGGAGATCTGGTTGCTGGACCTGCGGCCG
GAAGTGCGGTGGTGA
Transcript >Ophcf2|04806
ATGTCGTCGCTTGCTCTTCTGAGCCTCCTTCAGCTGGTGGTGGCGGCCGTCGGCGTCTGGAGCAAGCTGCGGTCT
GGCTTCGGGCTGGTAGAGGTGCCGAGTCCGGCTCGTCTGATTGAGCCCGGCTGTTGGCTCGAGGATCTTGGAGGG
CTCATCCCGTTTGCCATCATGGTGGAGATGATATCACCGGTCAGGAAGTTGAGAGCCGTCTCCTTACTGGGCTTG
CTATCGGCCATCTTGGGCTTCGCCGCCGCCATGCCGGCCCTCTCCCTGTGGATCCTGCAGGCAGCCGAGCACAAG
GCCCTCAGCCGGAGACAGAGGTCCGTCCTAGGCAAGCTAGCCTTCCTATCGGCTGTGACGCACGTGGGAGCCTTT
GTCGTGGCACTTTCCACGGCCTGTCTCGGCCTCGACTCCAGCCCCTGGCACGTCATGAACAGCCTGCTATCCGGC
CCGGACCACCCCGGCCGTCTCCCGGAAAAGGCCTTGCGGGAGGCCCGTCTGCGGCAGATCAACGAGATGACGGGC
ACGTCGAGCGGCTTCTTCATGGCGGCCGGCTTGCTGCTGCTCAGGCTGGAGATCTGGTTGCTGGACCTGCGGCCG
GAAGTGCGGTGGTGA
Gene >Ophcf2|04806
ATGTCGTCGCTTGCTCTTCTGAGCCTCCTTCAGCTGGTGGTGGCGGCCGTCGGCGTCTGGAGCAAGCTGCGGTCT
GGCTTCGGGCTGGTAGAGGTGCCGAGTCCGGCTCGTCTGATTGAGCCCGGCTGTTGGCTCGAGGATCTTGGAGGG
GTATCTGTTGTTTTGTTATGGGAACAATGGCCTTGGTTCTCTCTGCATTTGTTTCTCTATCTTGGGCAGCTCATC
CCGTTTGCCATCATGGTGGAGATGATATCACCGGTCAGGAAGTTGAGGTAAGTCAAGCCGTTACGAATTCCCGAC
AACTACATCAGCTGATCCGTCTTCAAGAGCCGTCTCCTTACTGGGCTTGCTATCGGCCATCTTGGGCTTCGCCGC
CGCCATGCCGGCCCTCTCCCTGTGGATCCTGCAGGCAGCCGAGCACAAGGCCCTCAGCCGGAGACAGAGGTCCGT
CCTAGGCAAGCTAGCCTTCCTATCGGCTGTGACGCACGTGGGAGCCTTTGTCGTGGCACTTTCCACGGCCTGTCT
CGGCCTCGACTCCAGCCCCTGGCACGTCATGAACAGCCTGCTATCCGGCCCGGACCACCCCGGCCGTCTCCCGGA
AAAGGCCTTGCGGGAGGCCCGTCTGCGGCAGATCAACGAGATGACGGGCACGTCGAGCGGCTTCTTCATGGCGGC
CGGCTTGCTGCTGCTCAGGCTGGAGAGTTGCGGCCGGGGGATGAGCGTCGGGTTGGTGGCCTTGATGTTTCTCGT
AAGTCTGGTTGCTGGACCTGCGGCCGGAAGTGCGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail