Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04799
Gene name
Locationscaffold_05:1611513..1613062
Strand-
Gene length (bp)1549
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00647 EF1G Elongation factor 1 gamma, conserved domain 6.3E-43 248 354
PF00043 GST_C Glutathione S-transferase, C-terminal domain 6.7E-12 96 196
PF02798 GST_N Glutathione S-transferase, N-terminal domain 2.7E-06 4 74
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 2.2E-06 131 190
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.7E-04 132 196

GO

GO Term Description Terminal node
GO:0006749 glutathione metabolic process Yes
GO:0006414 translational elongation Yes
GO:0003746 translation elongation factor activity Yes
GO:0005515 protein binding Yes
GO:0006575 cellular modified amino acid metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0006790 sulfur compound metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0008135 translation factor activity, RNA binding No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6286 0.2284 0.0151 0.2461 0.0976 0.0151 0.1196 0.073 0.0707 0.0088

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1843
Ophiocordyceps australis map64 (Brazil) OphauB2|7372
Ophiocordyceps camponoti-floridani Ophcf2|04799 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|57
Ophiocordyceps kimflemingae Ophio5|5366
Ophiocordyceps subramaniannii Hirsu2|6635

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04799
MAFGTLFTTADNPRSTAIKAIAKANKLDLKIVEVEHGSPSIEHLKANGLGKIPAFVGEDGYTLSECIAVAIYITS
QNEKTTLLGKTKQDYASILKWMSFFNSEIVPPLGNWFLPLVGRMPYNKKTVEDGSKATAKAIGVVENYLIRHTYL
VGERITLADLFCAALLNRGFQYFFDKQWRQQNPCVARWYDTVVSQPIYTAVAKKIDYLDKPALTNTAPKKPEQPK
AAAPKAAPAAAADDEEDAPAAPKAKHPCEALPKASFPLDEWKRHFSNNETPDALKWFWEKVPLEEEYSIWRCDYK
YNDELTLTFMSNNLIGGLFARLEGSRKYIFGSASVYGENNDSVIQGAFVIRGQEYKPVFDVAPDYESYDFAKLDP
KNEKDREFLENMWSWEKPVVVKGKEYAHACGKVFK*
Coding >Ophcf2|04799
ATGGCTTTCGGCACTCTCTTCACCACAGCGGACAATCCCCGCTCGACCGCCATCAAGGCCATCGCAAAGGCCAAT
AAGCTCGACCTCAAGATTGTCGAGGTCGAGCATGGCAGCCCCAGCATCGAGCACCTCAAGGCAAACGGGCTCGGC
AAGATTCCCGCCTTTGTGGGCGAAGATGGTTACACTCTGTCCGAGTGCATTGCTGTCGCCATCTACATCACCTCG
CAGAACGAAAAGACCACACTGCTGGGGAAGACCAAGCAAGATTATGCCTCAATCTTGAAATGGATGTCCTTCTTC
AACTCGGAAATCGTCCCTCCCCTGGGCAACTGGTTCTTGCCCCTCGTTGGCAGGATGCCCTACAACAAGAAGACT
GTCGAGGATGGCTCCAAGGCTACCGCCAAGGCCATTGGCGTCGTCGAAAACTACTTGATCCGCCACACCTACCTT
GTCGGCGAGCGCATTACTCTTGCCGACTTATTCTGTGCCGCCCTCCTGAACCGAGGCTTCCAGTACTTCTTCGAC
AAGCAGTGGCGCCAGCAGAACCCCTGTGTCGCTCGCTGGTACGATACCGTTGTCTCCCAGCCCATCTACACAGCC
GTCGCCAAGAAGATCGATTACCTCGACAAGCCTGCCCTCACCAACACTGCTCCTAAGAAGCCCGAGCAGCCCAAG
GCCGCCGCCCCCAAGGCTGCCCCCGCTGCTGCTGCCGATGACGAGGAGGACGCTCCGGCAGCTCCAAAGGCTAAG
CACCCCTGCGAGGCCCTGCCCAAGGCATCGTTCCCTCTGGATGAGTGGAAGCGCCACTTCTCCAACAACGAGACT
CCGGACGCTCTCAAGTGGTTCTGGGAGAAAGTTCCCCTGGAGGAGGAGTATTCCATCTGGCGCTGCGATTACAAG
TACAACGATGAGCTCACCCTAACATTTATGTCCAACAACCTCATTGGCGGCCTCTTTGCTCGTCTGGAGGGTTCT
CGCAAGTACATCTTCGGCAGCGCCTCCGTATACGGCGAGAACAACGATTCGGTCATCCAGGGCGCCTTTGTCATC
CGAGGTCAGGAATACAAGCCTGTGTTCGACGTCGCTCCGGACTACGAGAGCTACGATTTCGCCAAGCTCGATCCC
AAGAACGAAAAAGACCGCGAGTTCCTCGAGAATATGTGGTCTTGGGAGAAACCCGTCGTTGTCAAGGGCAAAGAG
TACGCTCATGCTTGCGGCAAGGTGTTCAAATAG
Transcript >Ophcf2|04799
ATGGCTTTCGGCACTCTCTTCACCACAGCGGACAATCCCCGCTCGACCGCCATCAAGGCCATCGCAAAGGCCAAT
AAGCTCGACCTCAAGATTGTCGAGGTCGAGCATGGCAGCCCCAGCATCGAGCACCTCAAGGCAAACGGGCTCGGC
AAGATTCCCGCCTTTGTGGGCGAAGATGGTTACACTCTGTCCGAGTGCATTGCTGTCGCCATCTACATCACCTCG
CAGAACGAAAAGACCACACTGCTGGGGAAGACCAAGCAAGATTATGCCTCAATCTTGAAATGGATGTCCTTCTTC
AACTCGGAAATCGTCCCTCCCCTGGGCAACTGGTTCTTGCCCCTCGTTGGCAGGATGCCCTACAACAAGAAGACT
GTCGAGGATGGCTCCAAGGCTACCGCCAAGGCCATTGGCGTCGTCGAAAACTACTTGATCCGCCACACCTACCTT
GTCGGCGAGCGCATTACTCTTGCCGACTTATTCTGTGCCGCCCTCCTGAACCGAGGCTTCCAGTACTTCTTCGAC
AAGCAGTGGCGCCAGCAGAACCCCTGTGTCGCTCGCTGGTACGATACCGTTGTCTCCCAGCCCATCTACACAGCC
GTCGCCAAGAAGATCGATTACCTCGACAAGCCTGCCCTCACCAACACTGCTCCTAAGAAGCCCGAGCAGCCCAAG
GCCGCCGCCCCCAAGGCTGCCCCCGCTGCTGCTGCCGATGACGAGGAGGACGCTCCGGCAGCTCCAAAGGCTAAG
CACCCCTGCGAGGCCCTGCCCAAGGCATCGTTCCCTCTGGATGAGTGGAAGCGCCACTTCTCCAACAACGAGACT
CCGGACGCTCTCAAGTGGTTCTGGGAGAAAGTTCCCCTGGAGGAGGAGTATTCCATCTGGCGCTGCGATTACAAG
TACAACGATGAGCTCACCCTAACATTTATGTCCAACAACCTCATTGGCGGCCTCTTTGCTCGTCTGGAGGGTTCT
CGCAAGTACATCTTCGGCAGCGCCTCCGTATACGGCGAGAACAACGATTCGGTCATCCAGGGCGCCTTTGTCATC
CGAGGTCAGGAATACAAGCCTGTGTTCGACGTCGCTCCGGACTACGAGAGCTACGATTTCGCCAAGCTCGATCCC
AAGAACGAAAAAGACCGCGAGTTCCTCGAGAATATGTGGTCTTGGGAGAAACCCGTCGTTGTCAAGGGCAAAGAG
TACGCTCATGCTTGCGGCAAGGTGTTCAAATAG
Gene >Ophcf2|04799
ATGGCTTTCGGCACTCTCTTCACCACAGCGGTAAGTCTCAAGATTCGGCACCGCATCTTTCCGTCTTTCCTCCTA
GCTGCTTCTGACCCTCCGCCGCCTGCAGGACAATCCCCGCTCGACCGCCATCAAGGCCATCGCAAAGGCCAATAA
GCTCGACCTCAAGATTGTCGAGGTCGAGCATGGCAGCCCCAGCATCGAGCACCTCAAGGCAAACGGGCTCGGCAA
GATTCCCGCCTTTGTGGGCGAAGATGGTTACACTCTGTCCGAGTGCATTGCTGTCGCCATCTACAGTACGTTTTT
CCTTAACTTGATCGCCCGCTACTTCGTCGCGTGATGATATGATCTATTTCATCAATATACAGTTTATCCCTGTCT
GAATCTTCTCTGTGTTGCTATAGTCATCATCTGACGCTATCACTCTCATCTTTACTTGGTCCGAGACTTTGTCTG
GCGAACGGTTTCGTGCTGACATATTGCAGTCACCTCGCAGAACGAAAAGACCACACTGCTGGGGAAGACCAAGCA
AGAGTACGCACAAATGAGAATCAATCTACCATGTGGCTCATAGCTAACGCGTCCTAGTTATGCCTCAATCTTGAA
ATGGATGTCCTTCTTCAACTCGGAAATCGTCCCTCCCCTGGGCAACTGGTTCTTGCCCCTCGTTGGCAGGATGCC
CTACAACAAGAAGACTGTCGAGGATGGCTCCAAGGCTACCGCCAAGGCCATTGGCGTCGTCGAAAACTACTTGAT
CCGCCACACCTACCTTGTCGGCGAGCGCATTACTCTTGCCGACTTATTCTGTGCCGCCCTCCTGAACCGAGGCTT
CCAGTACTTCTTCGACAAGCAGTGGCGCCAGCAGAACCCCTGTGTCGCTCGCTGGTACGATACCGTTGTCTCCCA
GCCCATCTACACAGCCGTCGCCAAGAAGATCGATTACCTCGACAAGCCTGCCCTCACCAACACTGCTCCTAAGAA
GCCCGAGCAGCCCAAGGCCGCCGCCCCCAAGGCTGCCCCCGCTGCTGCTGCCGATGACGAGGAGGACGCTCCGGC
AGCTCCAAAGGCTAAGCACCCCTGCGAGGCCCTGCCCAAGGCATCGTTCCCTCTGGATGAGTGGAAGCGCCACTT
CTCCAACAACGAGACTCCGGACGCTCTCAAGTGGTTCTGGGAGAAAGTTCCCCTGGAGGAGGAGTATTCCATCTG
GCGCTGCGATTACAAGTACAACGATGAGCTCACCCTAACATTTATGTCCAACAACCTCATTGGCGGCCTCTTTGC
TCGTCTGGAGGGTTCTCGCAAGTACATCTTCGGCAGCGCCTCCGTATACGGCGAGAACAACGATTCGGTCATCCA
GGGCGCCTTTGTCATCCGAGGTCAGGAATACAAGCCTGTGTTCGACGTCGCTCCGGACTACGAGAGCTACGATTT
CGCCAAGCTCGATCCCAAGAACGAAAAAGACCGCGAGTTCCTCGAGAATATGTGGTCTTGGGAGAAACCCGTCGT
TGTCAAGGGCAAAGAGTACGCTCATGCTTGCGGCAAGGTGTTCAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail