Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04791
Gene name
Locationscaffold_05:1599937..1600993
Strand+
Gene length (bp)1056
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10357 Kin17_mid Domain of Kin17 curved DNA-binding protein 2.8E-53 52 177
PF12874 zf-met Zinc-finger of C2H2 type 2.6E-04 26 48

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3236 0.9223 0.0206 0.017 0.1118 0.0048 0.0361 0.0047 0.0225 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 46.32 24.34 68.30
Alive In ants, during behavior modification 59.00 31.92 86.09
Dead In ants, recently dead 68.68 38.14 99.22

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.255562 no
Alive Dead 0.420549 no
Dead Fungus 0.045988 yes

Orthologs

Orthofinder run ID4
Orthogroup1113
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1835
Ophiocordyceps australis map64 (Brazil) OphauB2|7380
Ophiocordyceps camponoti-floridani Ophcf2|04791 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|49
Ophiocordyceps kimflemingae Ophio5|826
Ophiocordyceps subramaniannii Hirsu2|10145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04791
MPKAEVGSTKYLSNKLKSKGLQRLRWYCQVCEKQCRDANGFKMHTQSEGHVRQMLVVGEDPRKFINDYSNQFQRD
FLQLLRTGHGEKQVHINQFYQEYIANKEHIHMNATKWPSLTEFAKHLGRESICRVEETEKGIHISWIDNSPEALR
RQEALRRKQAQDQGDEELEKRILKEQIRRAQASAAQRQTDEKEDDDSGHLLRQDGEKITMSFGPKKESEKPIVAA
SQDAPAATEAASPPETEKSGDTKPEPTKPAVFGGMKIGGKPQPKNVFALAKKKNVLADGASKKKIVADQPKKMSE
MERIMREEIERKRSREAAGFGMSSGKKHRST*
Coding >Ophcf2|04791
ATGCCCAAGGCCGAGGTCGGCTCGACCAAATACCTCTCCAACAAACTCAAGAGCAAAGGCCTTCAACGTCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGACGCAAATGGTTTCAAGATGCACACGCAGTCGGAAGGCCAC
GTACGGCAGATGCTGGTTGTTGGCGAGGACCCCAGGAAGTTCATCAACGATTACAGCAATCAGTTTCAGAGAGAC
TTTTTGCAGCTTCTGAGAACCGGTCACGGAGAAAAACAAGTTCATATTAACCAGTTCTATCAGGAGTACATCGCC
AACAAGGAGCACATCCATATGAACGCCACTAAATGGCCCTCACTGACCGAATTTGCCAAACACTTGGGGCGAGAG
AGCATTTGCCGTGTTGAGGAAACCGAAAAGGGTATCCATATCTCGTGGATCGACAATTCCCCCGAGGCTTTGCGA
CGACAGGAAGCGCTCCGCAGGAAGCAGGCACAGGACCAAGGCGACGAGGAACTTGAAAAGCGCATTTTGAAGGAG
CAAATCCGCAGAGCGCAGGCTAGTGCCGCTCAGCGCCAGACGGACGAAAAAGAGGACGACGATTCGGGACATCTT
CTCCGCCAGGATGGGGAAAAGATTACAATGTCATTTGGTCCGAAAAAAGAATCAGAAAAACCGATTGTCGCAGCC
AGCCAAGACGCCCCGGCGGCTACTGAGGCTGCTTCTCCCCCCGAAACCGAGAAAAGCGGCGATACCAAACCGGAA
CCTACGAAACCTGCCGTTTTCGGAGGGATGAAGATAGGCGGCAAGCCGCAGCCAAAGAACGTCTTTGCGCTGGCC
AAGAAAAAGAACGTTCTTGCGGACGGAGCGTCCAAAAAGAAAATCGTGGCCGATCAGCCGAAGAAGATGAGCGAG
ATGGAGAGAATCATGAGGGAGGAAATCGAGCGGAAACGGTCTAGGGAGGCGGCCGGCTTCGGCATGTCTTCTGGG
AAGAAGCATCGCAGCACTTGA
Transcript >Ophcf2|04791
ATGCCCAAGGCCGAGGTCGGCTCGACCAAATACCTCTCCAACAAACTCAAGAGCAAAGGCCTTCAACGTCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGACGCAAATGGTTTCAAGATGCACACGCAGTCGGAAGGCCAC
GTACGGCAGATGCTGGTTGTTGGCGAGGACCCCAGGAAGTTCATCAACGATTACAGCAATCAGTTTCAGAGAGAC
TTTTTGCAGCTTCTGAGAACCGGTCACGGAGAAAAACAAGTTCATATTAACCAGTTCTATCAGGAGTACATCGCC
AACAAGGAGCACATCCATATGAACGCCACTAAATGGCCCTCACTGACCGAATTTGCCAAACACTTGGGGCGAGAG
AGCATTTGCCGTGTTGAGGAAACCGAAAAGGGTATCCATATCTCGTGGATCGACAATTCCCCCGAGGCTTTGCGA
CGACAGGAAGCGCTCCGCAGGAAGCAGGCACAGGACCAAGGCGACGAGGAACTTGAAAAGCGCATTTTGAAGGAG
CAAATCCGCAGAGCGCAGGCTAGTGCCGCTCAGCGCCAGACGGACGAAAAAGAGGACGACGATTCGGGACATCTT
CTCCGCCAGGATGGGGAAAAGATTACAATGTCATTTGGTCCGAAAAAAGAATCAGAAAAACCGATTGTCGCAGCC
AGCCAAGACGCCCCGGCGGCTACTGAGGCTGCTTCTCCCCCCGAAACCGAGAAAAGCGGCGATACCAAACCGGAA
CCTACGAAACCTGCCGTTTTCGGAGGGATGAAGATAGGCGGCAAGCCGCAGCCAAAGAACGTCTTTGCGCTGGCC
AAGAAAAAGAACGTTCTTGCGGACGGAGCGTCCAAAAAGAAAATCGTGGCCGATCAGCCGAAGAAGATGAGCGAG
ATGGAGAGAATCATGAGGGAGGAAATCGAGCGGAAACGGTCTAGGGAGGCGGCCGGCTTCGGCATGTCTTCTGGG
AAGAAGCATCGCAGCACTTGA
Gene >Ophcf2|04791
ATGCCCAAGGCCGAGGTCGGCTCGACCAAATACCTCTCCAACAAACTCAAGAGCAAAGGCCTTCAACGTCTGCGC
TGGTACTGCCAGGTGTGCGAGAAACAATGCAGGGACGCAAATGGTTTCAAGATGCACACGCAGTCGGAAGGCCAC
GTACGGCAGATGCTGGTTGTTGGCGAGGACCCCAGGAAGTTCATCAACGATTACAGCAATCAGTTTCAGAGAGAC
TTTTTGCAGCTTCTGAGAACCGGTCACGGAGAAAAACAAGTTCATATTAACCAGTTCTATCAGGAGTACATCGCC
AACAAGGTATAGGACGCGCCGATGCTCCTTTAAATCTCCTAACACAACAGAGCTGACGGCGACCAGGAGCACATC
CATATGAACGCCACTAAATGGCCCTCACTGACCGAATTTGCCAAACACTTGGGGCGAGAGAGCATTTGCCGTGTT
GAGGAAACCGAAAAGGGTATCCATATCTCGTGGATCGACAATTCCCCCGAGGCTTTGCGACGACAGGAAGCGCTC
CGCAGGAAGCAGGCACAGGACCAAGGCGACGAGGAACTTGAAAAGCGCATTTTGAAGGAGCAAATCCGCAGAGCG
CAGGCTAGTGCCGCTCAGCGCCAGACGGACGAAAAAGAGGACGACGATTCGGGACATCTTCTCCGCCAGGATGGG
GAAAAGATTACAATGTCATTTGGTCCGAAAAAAGAATCAGAAAAACCGATTGTCGCAGCCAGCCAAGACGCCCCG
GCGGCTACTGAGGCTGCTTCTCCCCCCGAAACCGAGAAAAGCGGCGATACCAAACCGGAACCTACGAAACCTGCC
GTTTTCGGAGGGATGAAGATAGGCGGCAAGCCGCAGCCAAAGAACGTCTTTGCGCTGGCCAAGAAAAAGAACGTT
CTTGCGGACGGAGCGTCCAAAAAGAAAATCGTGGCCGATCAGCCGAAGAAGATGAGCGAGATGGAGAGAATCATG
AGGGAGGAAATCGAGCGGAAACGGTCTAGGGAGGCGGCCGGCTTCGGCATGTCTTCTGGGAAGAAGCATCGCAGC
ACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail