Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04785
Gene name
Locationscaffold_05:1582101..1583151
Strand-
Gene length (bp)1050
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03896 TRAP_alpha Translocon-associated protein (TRAP), alpha subunit 4.9E-07 97 249

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 174 196 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 282.48 156.13 408.83
Alive In ants, during behavior modification 214.42 114.03 314.82
Dead In ants, recently dead 169.02 95.92 242.12

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.171675 no
Alive Dead 0.174406 no
Dead Fungus 0.004680 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04785
MAIDRLFAHKLALLAAWAWGAKADGESPPPPPKPAQLAAEIKTTFPDADILGVHLVNGRPTKALVEVKNREGAPI
KVAYLAGALVGTQPLPADAPAYQAIVRNLTAVQYNLEIAAGEAKALPFSFMLDMQPQDVRLQLVAVVADPKGNIV
QLPAHNGTASIVEAPTSFFDPQIIFLYLVLSTAFASTLYFVYKTWIEALFPQAKRTKPAKKGRKAADGDAALSTA
DSSAVSPGAGKTYDESWIPDHHIKPPVAKRVKSGVGSGKKKGVE*
Coding >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGATGGC
GAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCAAGACAACCTTCCCGGACGCCGACATT
CTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTTAAGAACAGGGAGGGTGCCCCCATC
AAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGGCCGACGCACCGGCCTACCAGGCCATT
GTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGGAGGCCAAGGCTTTACCGTTTTCATTC
ATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTGTTGCTGATCCGAAGGGGAATATTGTT
CAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATCTTC
CTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGGATCGAAGCCCTGTTC
CCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCCGCGCTCTCGACCGCA
GACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGATCATCATATCAAGCCT
CCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG
Transcript >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGATGGC
GAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCAAGACAACCTTCCCGGACGCCGACATT
CTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTTAAGAACAGGGAGGGTGCCCCCATC
AAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGGCCGACGCACCGGCCTACCAGGCCATT
GTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGGAGGCCAAGGCTTTACCGTTTTCATTC
ATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTGTTGCTGATCCGAAGGGGAATATTGTT
CAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATCTTC
CTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGGATCGAAGCCCTGTTC
CCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCCGCGCTCTCGACCGCA
GACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGATCATCATATCAAGCCT
CCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG
Gene >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGTGAGGAGG
AGCTTGAGATTGGGTTTCGCGGCTTGGCGGCTTTTTCTTTTCCCTTGTTGATTGAGTTCATGGCTTTGGCATCTT
CCCGTTGCACTTCTCATCCGTCTCGATTCGTCCGAGAGAGGAAAACGGAAAAGATTGAAAAGGCTGACCGATGGA
AAATGTCGTCGAAATAGGCCGATGGCGAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCA
AGACAACCTTCCCGGACGCCGACATTCTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGG
TTAAGAACAGGGAGGGTGCCCCCATCAAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGG
CCGACGCACCGGCCTACCAGGCCATTGTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGG
AGGCCAAGGCTTTACCGTTTTCATTCATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTG
TTGCTGATCCGAAGGGGAATATTGTTCAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGA
GCTTCTTTGATCCTCAGATGTGCGTTTCTGTTTTCAACCCTTTACTTTGTCTTGTCATGATGAATATGCTGATAT
TCGCTTAGCATCTTCCTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGG
ATCGAAGCCCTGTTCCCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCC
GCGCTCTCGACCGCAGACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGAT
CATCATATCAAGCCTCCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail