Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04785
Gene name
Locationscaffold_05:1582101..1583151
Strand-
Gene length (bp)1050
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03896 TRAP_alpha Translocon-associated protein (TRAP), alpha subunit 4.9E-07 97 249

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 174 196 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04785
MAIDRLFAHKLALLAAWAWGAKADGESPPPPPKPAQLAAEIKTTFPDADILGVHLVNGRPTKALVEVKNREGAPI
KVAYLAGALVGTQPLPADAPAYQAIVRNLTAVQYNLEIAAGEAKALPFSFMLDMQPQDVRLQLVAVVADPKGNIV
QLPAHNGTASIVEAPTSFFDPQIIFLYLVLSTAFASTLYFVYKTWIEALFPQAKRTKPAKKGRKAADGDAALSTA
DSSAVSPGAGKTYDESWIPDHHIKPPVAKRVKSGVGSGKKKGVE*
Coding >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGATGGC
GAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCAAGACAACCTTCCCGGACGCCGACATT
CTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTTAAGAACAGGGAGGGTGCCCCCATC
AAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGGCCGACGCACCGGCCTACCAGGCCATT
GTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGGAGGCCAAGGCTTTACCGTTTTCATTC
ATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTGTTGCTGATCCGAAGGGGAATATTGTT
CAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATCTTC
CTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGGATCGAAGCCCTGTTC
CCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCCGCGCTCTCGACCGCA
GACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGATCATCATATCAAGCCT
CCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG
Transcript >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGATGGC
GAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCAAGACAACCTTCCCGGACGCCGACATT
CTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTTAAGAACAGGGAGGGTGCCCCCATC
AAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGGCCGACGCACCGGCCTACCAGGCCATT
GTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGGAGGCCAAGGCTTTACCGTTTTCATTC
ATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTGTTGCTGATCCGAAGGGGAATATTGTT
CAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATCTTC
CTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGGATCGAAGCCCTGTTC
CCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCCGCGCTCTCGACCGCA
GACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGATCATCATATCAAGCCT
CCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG
Gene >Ophcf2|04785
ATGGCTATCGATCGTCTCTTCGCCCACAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGTGAGGAGG
AGCTTGAGATTGGGTTTCGCGGCTTGGCGGCTTTTTCTTTTCCCTTGTTGATTGAGTTCATGGCTTTGGCATCTT
CCCGTTGCACTTCTCATCCGTCTCGATTCGTCCGAGAGAGGAAAACGGAAAAGATTGAAAAGGCTGACCGATGGA
AAATGTCGTCGAAATAGGCCGATGGCGAATCTCCTCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGAAATCA
AGACAACCTTCCCGGACGCCGACATTCTGGGCGTGCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGG
TTAAGAACAGGGAGGGTGCCCCCATCAAGGTGGCCTACCTAGCTGGCGCTCTGGTCGGCACCCAGCCGCTGCCGG
CCGACGCACCGGCCTACCAGGCCATTGTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCAGCGGGGG
AGGCCAAGGCTTTACCGTTTTCATTCATGCTGGATATGCAGCCTCAGGATGTTCGACTTCAGCTAGTGGCCGTTG
TTGCTGATCCGAAGGGGAATATTGTTCAGTTGCCGGCTCATAACGGGACGGCTTCGATAGTTGAGGCTCCTACGA
GCTTCTTTGATCCTCAGATGTGCGTTTCTGTTTTCAACCCTTTACTTTGTCTTGTCATGATGAATATGCTGATAT
TCGCTTAGCATCTTCCTGTACCTCGTTCTGTCAACCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAAACCTGG
ATCGAAGCCCTGTTCCCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAGGAAGGCAGCCGATGGCGACGCC
GCGCTCTCGACCGCAGACTCATCCGCTGTCTCGCCCGGCGCCGGAAAGACGTACGACGAGAGCTGGATTCCCGAT
CATCATATCAAGCCTCCTGTCGCCAAGCGCGTCAAGTCTGGCGTCGGCAGTGGCAAGAAGAAGGGTGTTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail