Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04779
Gene name
Locationscaffold_05:1570640..1573018
Strand+
Gene length (bp)2378
Transcript length (bp)2154
Coding sequence length (bp)2154
Protein length (aa) 718

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 5.9E-45 362 624
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 3.2E-29 70 312
PF14310 Fn3-like Fibronectin type III-like domain 3.3E-15 671 716

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2247 0.1157 0.7524 0.1079 0.1311 0.1672 0.3606 0.441 0.1133 0.0087

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.97843

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 2.3E-54 68 281

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup67
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1031
Ophiocordyceps australis 1348a (Ghana) OphauG2|1889
Ophiocordyceps australis 1348a (Ghana) OphauG2|6876
Ophiocordyceps australis 1348a (Ghana) OphauG2|89
Ophiocordyceps australis map64 (Brazil) OphauB2|163
Ophiocordyceps australis map64 (Brazil) OphauB2|1634
Ophiocordyceps australis map64 (Brazil) OphauB2|3785
Ophiocordyceps camponoti-floridani Ophcf2|00746
Ophiocordyceps camponoti-floridani Ophcf2|04779 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1641
Ophiocordyceps camponoti-rufipedis Ophun1|38
Ophiocordyceps kimflemingae Ophio5|272
Ophiocordyceps kimflemingae Ophio5|841
Ophiocordyceps subramaniannii Hirsu2|10976
Ophiocordyceps subramaniannii Hirsu2|937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04779
MWPLSSSLLLVLLFTPPSSSTSSSQARDWATAKSLAHHLVQRMTEAEKANLTRGFSLTSNVCAGNSGSVPRLGFP
GLCLHDAADGLRATDMVSAYPAGLHAGAAWDRGLAYHRALYMGREFRAKGVNVVLGPNAGPLGRTPLGGRNWEAF
SVDPYLSGQLIAETIAGFREAGVIASIKHLVANEQETLRRPYAGIEAVSSNIDDATLNEYYLWPFVDGVRAGAGS
VMCAYNRLNGTYACDHGQLLNGLLKTDMAFSGFVLLDWNAQHELGSANAGLDMVMPRAGAWGDNLTRAVADGIVS
EARLDDMATRIIGAWYLVGQDAPDFPSPGIGMKNLTEPHAPIDARESASRPVLLHGAEAGHVLVKNEAGALPLKS
RLAMISVFGYDAAVPRSKNVDAVFQLGYSSSPEMAQAILGSKQHFDQAARGGTIIVGGRAGANAPPYMSDPLSAL
QQRAEADGTWINWDVDSAEPDVNGASEACLVFINAMATEGWDRQGLRDEASDSLVRHVAGRCANTIVVIHAAGPR
LVDGWIDEANVTAVIIAHLPGQDSGRALVRLLYGDVNFSGRLPYTLARDERDYPVYEACGDGNSTDPQCDFVEGV
YLDYRSFDARRLKPRFEFGFGLSYTSFSYSDLASTPTNLKAWEEDDSQDIWEEAAVVTARLANDGDVAGAEVAQL
YVAIPDRPPRQLRGFEKVWLEAGEETTVRFALTRRDLSVWDS*
Coding >Ophcf2|04779
ATGTGGCCGCTCTCCTCTTCTCTCCTCCTCGTCCTCCTCTTCACTCCCCCCTCCTCTTCCACCTCCTCATCTCAA
GCCCGCGACTGGGCTACCGCCAAATCTCTCGCCCACCACCTCGTCCAGCGCATGACCGAGGCAGAAAAAGCCAAC
CTGACACGAGGCTTCTCCCTAACCTCCAACGTCTGCGCCGGAAACTCAGGCTCCGTCCCGCGCCTCGGCTTCCCG
GGCCTCTGTCTCCACGATGCCGCCGACGGTCTGCGGGCCACAGACATGGTCAGCGCCTATCCCGCAGGCCTGCAT
GCTGGCGCGGCCTGGGATCGTGGCCTGGCCTATCATCGCGCTCTGTACATGGGTCGCGAGTTTCGGGCCAAAGGC
GTCAATGTCGTCCTCGGTCCCAATGCTGGTCCTCTAGGTCGTACGCCCCTAGGAGGCCGTAACTGGGAAGCCTTT
TCCGTCGATCCCTATCTCAGCGGGCAGCTCATTGCCGAGACCATCGCCGGGTTTCGCGAGGCCGGCGTCATCGCC
AGCATCAAGCACCTCGTCGCCAACGAACAGGAGACGCTACGTCGCCCTTACGCCGGCATCGAAGCCGTCTCTTCC
AATATCGACGATGCCACCCTCAACGAGTACTACCTCTGGCCCTTTGTCGACGGCGTCCGCGCCGGAGCTGGCTCC
GTCATGTGCGCCTACAACCGTCTCAACGGCACTTATGCTTGTGACCACGGCCAGCTCCTCAACGGACTTCTCAAG
ACCGACATGGCCTTCTCCGGTTTCGTCTTGCTGGACTGGAACGCTCAGCACGAGCTCGGCAGCGCCAACGCAGGT
CTCGACATGGTTATGCCTCGTGCTGGCGCCTGGGGCGATAACCTGACGCGAGCCGTGGCTGATGGTATCGTGTCC
GAGGCACGGCTGGATGACATGGCCACCAGGATCATCGGCGCTTGGTATCTCGTCGGCCAAGATGCACCTGATTTC
CCCTCACCGGGTATCGGCATGAAGAACCTCACGGAACCACATGCTCCCATCGACGCCCGTGAGTCCGCCTCCCGT
CCCGTACTCCTCCACGGCGCCGAAGCCGGCCACGTGCTGGTCAAGAACGAGGCCGGCGCGTTGCCGCTGAAGTCG
CGGCTCGCCATGATCTCCGTCTTCGGCTACGACGCCGCCGTGCCGCGGTCCAAGAACGTAGACGCCGTTTTTCAG
CTGGGCTACTCGTCATCGCCCGAGATGGCACAAGCCATCCTCGGCTCCAAGCAGCACTTCGACCAAGCGGCTCGT
GGAGGCACCATCATCGTCGGAGGGCGCGCGGGGGCCAATGCGCCGCCGTACATGAGCGATCCCCTGAGCGCTCTT
CAGCAGCGAGCCGAGGCAGACGGAACCTGGATCAACTGGGATGTCGACTCGGCTGAGCCTGACGTCAACGGCGCG
TCCGAAGCCTGCCTAGTCTTCATCAACGCCATGGCGACAGAAGGCTGGGATCGACAGGGTCTCCGCGATGAGGCC
AGCGATAGCCTCGTGCGTCACGTCGCAGGACGCTGCGCCAACACCATAGTCGTCATACACGCTGCCGGGCCGCGT
CTCGTCGACGGCTGGATCGACGAGGCCAACGTGACGGCCGTCATCATCGCCCATCTGCCGGGTCAAGATAGTGGC
CGTGCCCTCGTCCGGTTGCTGTACGGAGACGTCAACTTTTCAGGCCGACTTCCATACACACTGGCGCGCGACGAG
AGGGACTATCCCGTCTACGAGGCCTGTGGCGATGGCAACTCGACGGATCCGCAGTGCGACTTTGTAGAGGGCGTT
TACCTCGACTATCGCAGCTTCGACGCTCGACGCCTAAAGCCTCGCTTTGAATTCGGCTTCGGTCTTAGCTACACG
TCCTTTTCCTACTCGGATCTCGCCTCGACGCCCACCAACCTGAAAGCCTGGGAGGAAGATGACAGCCAAGACATA
TGGGAAGAAGCAGCCGTCGTGACAGCGCGGTTAGCCAACGACGGCGACGTAGCTGGCGCTGAGGTAGCCCAGCTA
TACGTTGCCATCCCCGACCGTCCGCCGCGACAACTGCGTGGCTTCGAAAAGGTCTGGCTTGAGGCTGGCGAAGAG
ACGACGGTGCGGTTTGCGCTGACGCGGCGCGACCTGAGTGTGTGGGATTCGTGA
Transcript >Ophcf2|04779
ATGTGGCCGCTCTCCTCTTCTCTCCTCCTCGTCCTCCTCTTCACTCCCCCCTCCTCTTCCACCTCCTCATCTCAA
GCCCGCGACTGGGCTACCGCCAAATCTCTCGCCCACCACCTCGTCCAGCGCATGACCGAGGCAGAAAAAGCCAAC
CTGACACGAGGCTTCTCCCTAACCTCCAACGTCTGCGCCGGAAACTCAGGCTCCGTCCCGCGCCTCGGCTTCCCG
GGCCTCTGTCTCCACGATGCCGCCGACGGTCTGCGGGCCACAGACATGGTCAGCGCCTATCCCGCAGGCCTGCAT
GCTGGCGCGGCCTGGGATCGTGGCCTGGCCTATCATCGCGCTCTGTACATGGGTCGCGAGTTTCGGGCCAAAGGC
GTCAATGTCGTCCTCGGTCCCAATGCTGGTCCTCTAGGTCGTACGCCCCTAGGAGGCCGTAACTGGGAAGCCTTT
TCCGTCGATCCCTATCTCAGCGGGCAGCTCATTGCCGAGACCATCGCCGGGTTTCGCGAGGCCGGCGTCATCGCC
AGCATCAAGCACCTCGTCGCCAACGAACAGGAGACGCTACGTCGCCCTTACGCCGGCATCGAAGCCGTCTCTTCC
AATATCGACGATGCCACCCTCAACGAGTACTACCTCTGGCCCTTTGTCGACGGCGTCCGCGCCGGAGCTGGCTCC
GTCATGTGCGCCTACAACCGTCTCAACGGCACTTATGCTTGTGACCACGGCCAGCTCCTCAACGGACTTCTCAAG
ACCGACATGGCCTTCTCCGGTTTCGTCTTGCTGGACTGGAACGCTCAGCACGAGCTCGGCAGCGCCAACGCAGGT
CTCGACATGGTTATGCCTCGTGCTGGCGCCTGGGGCGATAACCTGACGCGAGCCGTGGCTGATGGTATCGTGTCC
GAGGCACGGCTGGATGACATGGCCACCAGGATCATCGGCGCTTGGTATCTCGTCGGCCAAGATGCACCTGATTTC
CCCTCACCGGGTATCGGCATGAAGAACCTCACGGAACCACATGCTCCCATCGACGCCCGTGAGTCCGCCTCCCGT
CCCGTACTCCTCCACGGCGCCGAAGCCGGCCACGTGCTGGTCAAGAACGAGGCCGGCGCGTTGCCGCTGAAGTCG
CGGCTCGCCATGATCTCCGTCTTCGGCTACGACGCCGCCGTGCCGCGGTCCAAGAACGTAGACGCCGTTTTTCAG
CTGGGCTACTCGTCATCGCCCGAGATGGCACAAGCCATCCTCGGCTCCAAGCAGCACTTCGACCAAGCGGCTCGT
GGAGGCACCATCATCGTCGGAGGGCGCGCGGGGGCCAATGCGCCGCCGTACATGAGCGATCCCCTGAGCGCTCTT
CAGCAGCGAGCCGAGGCAGACGGAACCTGGATCAACTGGGATGTCGACTCGGCTGAGCCTGACGTCAACGGCGCG
TCCGAAGCCTGCCTAGTCTTCATCAACGCCATGGCGACAGAAGGCTGGGATCGACAGGGTCTCCGCGATGAGGCC
AGCGATAGCCTCGTGCGTCACGTCGCAGGACGCTGCGCCAACACCATAGTCGTCATACACGCTGCCGGGCCGCGT
CTCGTCGACGGCTGGATCGACGAGGCCAACGTGACGGCCGTCATCATCGCCCATCTGCCGGGTCAAGATAGTGGC
CGTGCCCTCGTCCGGTTGCTGTACGGAGACGTCAACTTTTCAGGCCGACTTCCATACACACTGGCGCGCGACGAG
AGGGACTATCCCGTCTACGAGGCCTGTGGCGATGGCAACTCGACGGATCCGCAGTGCGACTTTGTAGAGGGCGTT
TACCTCGACTATCGCAGCTTCGACGCTCGACGCCTAAAGCCTCGCTTTGAATTCGGCTTCGGTCTTAGCTACACG
TCCTTTTCCTACTCGGATCTCGCCTCGACGCCCACCAACCTGAAAGCCTGGGAGGAAGATGACAGCCAAGACATA
TGGGAAGAAGCAGCCGTCGTGACAGCGCGGTTAGCCAACGACGGCGACGTAGCTGGCGCTGAGGTAGCCCAGCTA
TACGTTGCCATCCCCGACCGTCCGCCGCGACAACTGCGTGGCTTCGAAAAGGTCTGGCTTGAGGCTGGCGAAGAG
ACGACGGTGCGGTTTGCGCTGACGCGGCGCGACCTGAGTGTGTGGGATTCGTGA
Gene >Ophcf2|04779
ATGTGGCCGCTCTCCTCTTCTCTCCTCCTCGTCCTCCTCTTCACTCCCCCCTCCTCTTCCACCTCCTCATCTCAA
GCCCGCGACTGGGCTACCGCCAAATCTCTCGCCCACCACCTCGTCCAGCGCATGACCGAGGCAGAAAAAGCCAAC
CTGACACGAGGCTTCTCCCTAACCTCCAACGTCTGCGCCGGAAACTCAGGCTCCGTCCCGCGCCTCGGCTTCCCG
GGCCTCTGTCTCCACGATGCCGCCGACGGTCTGCGGGCCACAGACATGGTCAGCGCCTATCCCGCAGGCCTGCAT
GCTGGCGCGGCCTGGGATCGTGGCCTGGCCTATCATCGCGCTCTGTACATGGGTCGCGAGTTTCGGGCCAAAGGC
GGTGGGTGAATCTGACGGATGGATATGTTCGACGCTTCTGCTTAATGACTTGGTAGTCAATGTCGTCCTCGGTCC
CAATGCTGGTCCTCTAGGTCGTACGCCCCTAGGAGGCCGTAACTGGGAAGCCTTTTCCGTCGATCCCTATCTCAG
CGGGCAGCTCATTGCCGAGACCATCGCCGGGTTTCGCGAGGCCGGCGTCATCGCCAGCATCAAGGCGAGTTGCTC
TTGGTTAAGTGTCTGTCCGACTGTCTGACTTGGCTCAGCACCTCGTCGCCAACGAACAGGAGACGCTACGTCGCC
CTTACGCCGGCATCGAAGCCGTCTCTTCCAATATCGACGATGCCACCCTCAACGAGTACTACCTCTGGCCCTTTG
TCGACGGCGTCCGCGCCGGAGCTGGCTCCGTCATGTGCGCCTACAACCGTCTCAACGGCACTTATGCTTGTGACC
ACGGCCAGCTCCTCAACGGACTTCTCAAGACCGACATGGCCTTCTCCGGTTTCGTCTTGCTGGACTGGAACGCTC
AGCACGAGCTCGGCAGCGCCAACGCAGGTCTCGACATGGTTATGCCTCGTGCTGGCGCCTGGGGCGATAACCTGA
CGCGAGCCGTGGCTGATGGTATCGTGTCCGAGGCACGGCTGGATGACATGGCCACCAGGATCATCGGCGCTTGGT
ATCTCGTCGGCCAAGATGCACCTGATTTCCCCTCACCGGGTATCGGCATGAAGAACCTCACGGAACCACATGCTC
CCATCGACGCCCGTGAGTCCGCCTCCCGTCCCGTACTCCTCCACGGCGCCGAAGCCGGCCACGTGCTGGTCAAGA
ACGAGGCCGGCGCGTTGCCGCTGAAGTCGCGGCTCGCCATGATCTCCGTCTTCGGCTACGACGCCGCCGTGCCGC
GGTCCAAGAACGTAGACGCCGTTTTTCAGCTGGGCTACTCGTCATCGCCCGAGATGGCACAAGCCATCCTCGGCT
CCAAGCAGCACTTCGACCAAGCGGCTCGTGGAGGCACCATCATCGTCGGAGGGCGCGCGGGGGCCAATGCGCCGC
CGTACATGAGCGATGTACGATGCGAGTTGTTCTTGAATCGAGATGATAATCGCTGATTGAACTTTTGTATAGCCC
CTGAGCGCTCTTCAGCAGCGAGCCGAGGCAGACGGAACCTGGATCAACTGGGATGTCGACTCGGCTGAGCCTGAC
GTCAACGGCGCGTCCGAAGCCTGCCTAGTCTTCATCAACGCCATGGCGACAGAAGGCTGGGATCGACAGGGTCTC
CGCGATGAGGCCAGCGATAGCCTCGTGCGTCACGTCGCAGGACGCTGCGCCAACACCATAGTCGTCATACACGCT
GCCGGGCCGCGTCTCGTCGACGGCTGGATCGACGAGGCCAACGTGACGGCCGTCATCATCGCCCATCTGCCGGGT
CAAGATAGTGGCCGTGCCCTCGTCCGGTTGCTGTACGGAGACGTCAACTTTTCAGGCCGACTTCCATACACACTG
GCGCGCGACGAGAGGGACTATCCCGTCTACGAGGCCTGTGGCGATGGCAACTCGACGGATCCGCAGTGCGACTTT
GTAGAGGGCGTTTACCTCGACTATCGCAGCTTCGACGCTCGACGCCTAAAGCCTCGCTTTGAATTCGGCTTCGGT
CTTAGCTACACGTCCTTTTCCTACTCGGATCTCGCCTCGACGCCCACCAACCTGAAAGCCTGGGAGGAAGATGAC
AGCCAAGACATATGGGAAGAAGCAGCCGTCGTGACAGCGCGGTTAGCCAACGACGGCGACGTAGCTGGCGCTGAG
GTAGCCCAGCTATACGTTGCCATCCCCGACCGTCCGCCGCGACAACTGCGTGGCTTCGAAAAGGTCTGGCTTGAG
GCTGGCGAAGAGACGACGGTGCGGTTTGCGCTGACGCGGCGCGACCTGAGTGTGTGGGATGTTGGACGTGGATGC
TGGGTTTTGCGAGGGGGGGATTATGGTGTTTTTGTTGGGGCGAGTAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail