Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04777
Gene name
Locationscaffold_05:1566870..1568615
Strand+
Gene length (bp)1745
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12929 Mid1 Stretch-activated Ca2+-permeable channel component 3.0E-144 83 528

GO

GO Term Description Terminal node
GO:0005262 calcium channel activity Yes
GO:0098703 calcium ion import across plasma membrane Yes
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0098662 inorganic cation transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0006812 cation transport No
GO:0034220 ion transmembrane transport No
GO:0098655 cation transmembrane transport No
GO:0015085 calcium ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0099587 inorganic ion import across plasma membrane No
GO:0006810 transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015267 channel activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0005216 ion channel activity No
GO:0051179 localization No
GO:0098657 import into cell No
GO:0070588 calcium ion transmembrane transport No
GO:0008150 biological_process No
GO:0046873 metal ion transmembrane transporter activity No
GO:0006816 calcium ion transport No
GO:0055085 transmembrane transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0005261 cation channel activity No
GO:0098739 import across plasma membrane No
GO:0030001 metal ion transport No
GO:0098659 inorganic cation import across plasma membrane No
GO:0015075 ion transmembrane transporter activity No
GO:0097553 calcium ion transmembrane import into cytosol No
GO:0022803 passive transmembrane transporter activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1833 0.1089 0.5434 0.481 0.1529 0.0169 0.1654 0.1833 0.174 0.0074

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3212
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4626
Ophiocordyceps australis map64 (Brazil) OphauB2|3780
Ophiocordyceps camponoti-floridani Ophcf2|04777 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|37
Ophiocordyceps kimflemingae Ophio5|5731
Ophiocordyceps subramaniannii Hirsu2|5787

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04777
MRVGFSDLDSRTSTYESEFFPLDRSIIGRAPVGVSALTKNKVTPMDLPSGSTVCFMIQREAMFGDSVGGRNPSQP
NAQARSKTLFLSANTCQQPSPGVNNASAPQLILVVSNSSELACHSPSKNSEAKTFTEGAVTLSLNMTGDLFVGVS
APNVSTDFRGGYNFEIGASPDDFLHRYEGEDRSELLWMDSDSTSAILATRNLTEEESEIKRVMVEPLPYELYVSN
VEVPSSIGLRHSYCGLRNTAQIRASQSSNNEANSPVKTAMTRRGPGGFPKQQFHFVSLNSSSKYTGILVKKARED
GLNKRQDKAADLGPGSVVFRATDFETISGSSCKIVTDLEFCNEIQYAVPGNDRRFNNTGLGKAYDDYARKMYANF
EKVMMQIPCDAPRTSLYSLARTCDDCKAAYKKWLCTVIMPRCEDFAASSNRFALARNVGQAFPNGTKLAPDVRLN
LEQKPASNSSRNKFIDQEVQPGPYKEVLPCEDLCYEVVQSCPARIGFKCPRPEFPGFETSYGRRDQDASTVSCNF
AGEARTPINGGSVLLPRLRRAAGAALFATAVVLGMWI*
Coding >Ophcf2|04777
ATGAGAGTCGGCTTCTCGGACCTCGATAGCCGTACGTCGACATACGAGTCCGAGTTCTTCCCCCTCGACCGCAGC
ATCATCGGGCGCGCGCCGGTGGGCGTCTCTGCGCTCACCAAGAACAAGGTTACCCCGATGGACCTGCCGTCCGGG
TCGACGGTATGCTTTATGATACAGAGAGAGGCCATGTTCGGTGACAGCGTGGGCGGCCGCAATCCGTCGCAGCCT
AACGCTCAAGCGCGTTCCAAGACTCTTTTTCTCTCGGCCAACACGTGTCAACAGCCGTCTCCCGGCGTTAACAAT
GCGAGTGCGCCGCAGCTGATACTGGTCGTCTCTAATTCGAGCGAGTTGGCTTGCCACAGCCCTTCCAAGAACAGC
GAGGCTAAGACCTTTACCGAGGGAGCCGTCACGCTCAGTCTCAATATGACGGGTGACCTTTTTGTCGGCGTCTCG
GCGCCGAACGTGTCGACCGACTTTCGCGGCGGCTACAACTTTGAAATCGGTGCTTCACCCGACGATTTCTTGCAT
CGTTACGAGGGCGAAGACCGGTCTGAGCTGTTGTGGATGGATAGCGACTCGACGTCGGCCATTCTCGCCACTCGC
AACCTGACGGAGGAAGAATCCGAGATCAAGCGCGTCATGGTCGAGCCTCTGCCGTACGAATTATACGTCAGCAAC
GTCGAGGTGCCTTCCAGCATCGGGCTGAGACACTCGTACTGCGGGCTGCGAAACACGGCCCAGATTCGGGCGAGC
CAGTCGAGCAACAACGAAGCCAACAGCCCCGTCAAGACAGCCATGACCCGAAGGGGGCCTGGGGGCTTCCCGAAG
CAGCAGTTCCACTTTGTCTCTCTCAACTCCAGCTCCAAGTACACGGGCATCCTGGTGAAGAAGGCACGTGAAGAC
GGTCTGAATAAGAGGCAGGACAAAGCGGCGGATCTCGGTCCGGGAAGCGTCGTCTTCCGTGCCACCGACTTTGAG
ACTATTAGCGGATCCAGCTGCAAGATCGTGACGGACCTCGAGTTCTGCAACGAGATCCAGTACGCGGTACCAGGC
AACGACCGACGCTTCAATAACACGGGACTGGGCAAGGCGTACGACGACTACGCAAGAAAGATGTACGCCAACTTT
GAAAAGGTCATGATGCAGATACCCTGCGACGCGCCACGGACATCGCTGTACTCGCTGGCACGCACCTGCGACGAC
TGCAAGGCCGCCTACAAGAAGTGGCTTTGCACCGTCATCATGCCGCGATGCGAGGACTTTGCCGCCAGCAGCAAC
CGGTTTGCACTGGCACGCAACGTGGGACAGGCCTTTCCCAACGGCACGAAGTTGGCTCCAGACGTGAGGCTGAAC
CTGGAGCAGAAGCCGGCGAGCAACTCGTCGCGGAATAAGTTCATCGACCAGGAGGTGCAGCCGGGCCCGTACAAG
GAGGTGTTGCCGTGCGAGGACCTGTGCTACGAGGTGGTGCAGAGCTGTCCGGCCAGGATTGGCTTCAAGTGTCCG
CGGCCCGAGTTTCCGGGCTTCGAGACGAGTTACGGGCGTCGAGACCAGGACGCGTCGACTGTGTCGTGTAACTTT
GCGGGCGAAGCGCGGACGCCAATCAATGGGGGCTCGGTGTTGCTCCCAAGGCTGAGGCGGGCTGCTGGCGCTGCT
CTGTTTGCGACGGCGGTGGTGCTGGGCATGTGGATATGA
Transcript >Ophcf2|04777
ATGAGAGTCGGCTTCTCGGACCTCGATAGCCGTACGTCGACATACGAGTCCGAGTTCTTCCCCCTCGACCGCAGC
ATCATCGGGCGCGCGCCGGTGGGCGTCTCTGCGCTCACCAAGAACAAGGTTACCCCGATGGACCTGCCGTCCGGG
TCGACGGTATGCTTTATGATACAGAGAGAGGCCATGTTCGGTGACAGCGTGGGCGGCCGCAATCCGTCGCAGCCT
AACGCTCAAGCGCGTTCCAAGACTCTTTTTCTCTCGGCCAACACGTGTCAACAGCCGTCTCCCGGCGTTAACAAT
GCGAGTGCGCCGCAGCTGATACTGGTCGTCTCTAATTCGAGCGAGTTGGCTTGCCACAGCCCTTCCAAGAACAGC
GAGGCTAAGACCTTTACCGAGGGAGCCGTCACGCTCAGTCTCAATATGACGGGTGACCTTTTTGTCGGCGTCTCG
GCGCCGAACGTGTCGACCGACTTTCGCGGCGGCTACAACTTTGAAATCGGTGCTTCACCCGACGATTTCTTGCAT
CGTTACGAGGGCGAAGACCGGTCTGAGCTGTTGTGGATGGATAGCGACTCGACGTCGGCCATTCTCGCCACTCGC
AACCTGACGGAGGAAGAATCCGAGATCAAGCGCGTCATGGTCGAGCCTCTGCCGTACGAATTATACGTCAGCAAC
GTCGAGGTGCCTTCCAGCATCGGGCTGAGACACTCGTACTGCGGGCTGCGAAACACGGCCCAGATTCGGGCGAGC
CAGTCGAGCAACAACGAAGCCAACAGCCCCGTCAAGACAGCCATGACCCGAAGGGGGCCTGGGGGCTTCCCGAAG
CAGCAGTTCCACTTTGTCTCTCTCAACTCCAGCTCCAAGTACACGGGCATCCTGGTGAAGAAGGCACGTGAAGAC
GGTCTGAATAAGAGGCAGGACAAAGCGGCGGATCTCGGTCCGGGAAGCGTCGTCTTCCGTGCCACCGACTTTGAG
ACTATTAGCGGATCCAGCTGCAAGATCGTGACGGACCTCGAGTTCTGCAACGAGATCCAGTACGCGGTACCAGGC
AACGACCGACGCTTCAATAACACGGGACTGGGCAAGGCGTACGACGACTACGCAAGAAAGATGTACGCCAACTTT
GAAAAGGTCATGATGCAGATACCCTGCGACGCGCCACGGACATCGCTGTACTCGCTGGCACGCACCTGCGACGAC
TGCAAGGCCGCCTACAAGAAGTGGCTTTGCACCGTCATCATGCCGCGATGCGAGGACTTTGCCGCCAGCAGCAAC
CGGTTTGCACTGGCACGCAACGTGGGACAGGCCTTTCCCAACGGCACGAAGTTGGCTCCAGACGTGAGGCTGAAC
CTGGAGCAGAAGCCGGCGAGCAACTCGTCGCGGAATAAGTTCATCGACCAGGAGGTGCAGCCGGGCCCGTACAAG
GAGGTGTTGCCGTGCGAGGACCTGTGCTACGAGGTGGTGCAGAGCTGTCCGGCCAGGATTGGCTTCAAGTGTCCG
CGGCCCGAGTTTCCGGGCTTCGAGACGAGTTACGGGCGTCGAGACCAGGACGCGTCGACTGTGTCGTGTAACTTT
GCGGGCGAAGCGCGGACGCCAATCAATGGGGGCTCGGTGTTGCTCCCAAGGCTGAGGCGGGCTGCTGGCGCTGCT
CTGTTTGCGACGGCGGTGGTGCTGGGCATGTGGATATGA
Gene >Ophcf2|04777
ATGAGAGTCGGCTTCTCGGACCTCGATAGCCGTACGTCGACATACGAGTCCGAGTTCTTCCCCCTCGACCGCAGC
ATCATCGGGCGCGCGCCGGTGGGCGTCTCTGCGCTCACCAAGAACAAGGTTACCCCGATGGACCTGCCGTCCGGG
TCGACGGTATGCTTTATGATACAGAGAGAGGCCATGTTCGGTGACAGCGTGGGCGGCCGCAATCCGTCGCAGCCT
AACGCTCAAGCGCGTTCCAAGACTCTTTTTCTCTCGGCCAACACGTGTCAACAGCCGTCTCCCGGCGTTAACAAT
GCGAGTGCGCCGCAGCTGATACTGGTCGTCTCTAATTCGAGCGAGTTGGCTTGCCACAGCCCTTCCAAGAACAGC
GAGGCTAAGACCTTTACCGAGGGAGCCGTCACGCTCAGTCTCAATATGACGGGTGACCTTTTTGTCGGCGTCTCG
GCGCCGAACGTGTCGACCGACTTTCGCGGCGGCTACAACTTTGAAATCGGTGCTTCACCCGACGATTTCTTGCAT
CGTTACGAGGGCGAAGACCGGTCTGAGCTGTTGTGGATGGATAGCGACTCGACGTCGGCCATTCTCGCCACTCGC
AACCTGACGGAGGAAGAATCCGAGATCAAGCGCGTCATGGTCGAGCCTCTGCCGTACGAATTATACGTCAGCAAC
GTCGAGGTGCCTTCCAGCATCGGGCTGAGACACTCGTACTGCGGGCTGCGAAACACGGCCCAGATTCGGGCGAGC
CAGTCGAGCAACAACGAAGCCAACAGCCCCGTCAAGACAGCCATGACCCGAAGGGGGCCTGGGGGCTTCCCGAAG
CAGCAGTTCCACTTTGTCTCTCTCAACTCCAGCTCCAAGTACACGGGCATCCTGGTGAAGAAGGCACGTGAAGAC
GGTCTGAATAAGAGGCAGGACAAAGCGGCGGATCTCGGTCCGGGAAGCGTCGTCTTCCGTGCCACCGACTTTGAG
ACTATTAGCGGTCAGTTTCGGGGCACCTGATGATGCATCTCGTTGGCTCGACTGACGACGAAACAGGATCCAGCT
GCAAGATCGTGACGGACCTCGAGTTCTGCAACGAGATCCAGTACGCGGTACCAGGCAACGACCGACGCTTCAATA
ACACGGGACTGGGCAAGGCGTACGACGACTACGCAAGAAAGATGTACGCCAACTTTGAAAAGGTCATGATGCAGA
TACCCTGCGACGCGCCACGGACATCGCTGTACTCGCTGGCACGCACCTGCGACGACTGCAAGGCCGCCTACAAGA
AGTGGCTTTGCACCGTCATCATGCCGCGATGCGAGGACTTTGCCGCCAGCAGCAACCGGTTTGCACTGGCACGCA
ACGTGGGACAGGCCTTTCCCAACGGCACGAAGTTGGCTCCAGACGTGAGGCTGAACCTGGAGCAGAAGCCGGCGA
GCAACTCGTCGCGGAATAAGTTCATCGACCAGGAGGTGCAGCCGGGCCCGTACAAGGAGGTGTTGCCGTGCGAGG
ACCTGTGCTACGAGGTGGTGCAGAGCTGTCCGGCCAGGATTGGCTTCAAGTGTCCGCGGCCCGAGTTTCCGGGCT
TCGAGACGAGTTACGGGCGTCGAGACCAGGACGCGTCGACTGTGTCGTGTAACTTTGCGGGCGAAGCGCGGACGC
CAATCAATGGGGGCTCGGTGTTGCTCCCAAGGCTGAGGCGGGCTGCTGGCGCTGCTCTGTTTGCGACGGCGGTGG
TGCTGGGCATGTGGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail