Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04767
Gene name
Locationscaffold_05:1541555..1542950
Strand+
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 1.2E-06 256 455

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6541 0.6483 0.0191 0.0544 0.0847 0.0183 0.1439 0.0701 0.1988 0.0096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3172
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7589
Ophiocordyceps australis map64 (Brazil) OphauB2|3726
Ophiocordyceps camponoti-floridani Ophcf2|04767 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|28
Ophiocordyceps kimflemingae Ophio5|5742
Ophiocordyceps subramaniannii Hirsu2|5677

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04767
MAGPVSSQEIAGIPAPALLLLPSPPQPATRARLHAAYRVPLTAVLKRLSRQRTPQTLVVAVASSVLVPSRTQDST
ASGISAESTAPCSVRWRSSQALLADIYALIASICASHNLSPYSDSEKLAAVDARVVLIHHPSSAALEAPLSSRRR
LSSATASKSSVVLDLATFAATVRPWSLFFHISSESGYELLADYLAHAEGRQLILQSQLVTVDGGISFSSQSPTPR
NAAGQSCAQKAQEQDEVDGEDAIVGYKTVCLGGTFDHLHPGHKLLLQAAVLLLKIPKVGEEPCTIIVGISNSELL
AKKEYVEEMQSWDERARAVIAFLATQFNTPTTEAAQVTRLEVDGGDTPTMELRVNFCDGTADVRCVDIRDPFGPT
ISEEAIDAIVVSGETREGGKAINSRRTDRGWRTLDIYEIDVLDATLADEEIEGSEDRQKKRHSVAANPAAKISST
DFRRRKAESRAHVG*
Coding >Ophcf2|04767
ATGGCCGGCCCTGTATCATCGCAAGAAATTGCTGGCATCCCCGCTCCAGCACTGCTCCTCCTGCCGTCACCTCCG
CAGCCCGCGACCCGAGCTCGCCTCCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCAAGCGGCTGAGCCGA
CAACGCACGCCTCAAACCCTCGTGGTCGCTGTTGCATCTTCTGTCCTGGTGCCGAGTCGCACTCAAGATTCGACC
GCAAGTGGAATATCGGCCGAGTCTACAGCTCCTTGCTCAGTCCGATGGCGATCCTCACAGGCGCTTCTCGCCGAT
ATCTACGCCTTGATAGCTTCTATTTGCGCCAGCCATAACCTCTCCCCTTACTCAGATAGCGAGAAACTGGCCGCC
GTCGATGCTCGCGTTGTCCTCATCCACCATCCTTCTAGCGCTGCGCTTGAAGCGCCGTTATCATCACGTCGTCGT
CTTTCTTCCGCCACGGCCTCAAAGAGCAGTGTTGTCCTAGACTTGGCTACCTTCGCCGCCACGGTTCGACCCTGG
AGTCTTTTCTTCCACATAAGCAGCGAGTCTGGCTACGAGCTGCTGGCAGACTACCTTGCCCATGCTGAGGGGCGA
CAACTGATCCTGCAAAGCCAGTTGGTAACTGTCGACGGCGGCATAAGCTTCTCTAGCCAATCCCCAACACCGCGC
AATGCGGCTGGTCAGTCTTGCGCGCAAAAAGCGCAAGAACAAGACGAGGTCGACGGTGAAGATGCCATCGTGGGA
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACATCCCGGCCACAAGTTGCTACTACAAGCCGCTGTC
TTACTACTCAAAATCCCGAAAGTTGGCGAAGAGCCTTGCACAATCATCGTTGGTATCTCCAACAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAGGAGATGCAGTCATGGGACGAACGCGCCCGCGCTGTCATCGCCTTTCTTGCCACG
CAATTCAACACACCTACGACAGAAGCAGCCCAAGTTACGAGGTTAGAGGTCGATGGCGGCGATACGCCGACAATG
GAGCTTCGGGTCAACTTCTGTGACGGCACTGCGGACGTTCGCTGCGTCGACATCCGCGACCCATTCGGTCCCACC
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGAGAGACTCGTGAAGGCGGCAAGGCCATCAACAGTAGG
AGGACAGACCGTGGATGGCGAACGCTCGATATTTATGAGATTGATGTGCTGGATGCGACTCTGGCTGACGAAGAG
ATCGAAGGCAGCGAGGATCGGCAAAAGAAAAGGCATTCGGTAGCCGCGAATCCAGCAGCCAAAATCAGCAGCACT
GATTTCCGGAGGCGCAAAGCGGAGTCGCGAGCGCACGTCGGATAG
Transcript >Ophcf2|04767
ATGGCCGGCCCTGTATCATCGCAAGAAATTGCTGGCATCCCCGCTCCAGCACTGCTCCTCCTGCCGTCACCTCCG
CAGCCCGCGACCCGAGCTCGCCTCCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCAAGCGGCTGAGCCGA
CAACGCACGCCTCAAACCCTCGTGGTCGCTGTTGCATCTTCTGTCCTGGTGCCGAGTCGCACTCAAGATTCGACC
GCAAGTGGAATATCGGCCGAGTCTACAGCTCCTTGCTCAGTCCGATGGCGATCCTCACAGGCGCTTCTCGCCGAT
ATCTACGCCTTGATAGCTTCTATTTGCGCCAGCCATAACCTCTCCCCTTACTCAGATAGCGAGAAACTGGCCGCC
GTCGATGCTCGCGTTGTCCTCATCCACCATCCTTCTAGCGCTGCGCTTGAAGCGCCGTTATCATCACGTCGTCGT
CTTTCTTCCGCCACGGCCTCAAAGAGCAGTGTTGTCCTAGACTTGGCTACCTTCGCCGCCACGGTTCGACCCTGG
AGTCTTTTCTTCCACATAAGCAGCGAGTCTGGCTACGAGCTGCTGGCAGACTACCTTGCCCATGCTGAGGGGCGA
CAACTGATCCTGCAAAGCCAGTTGGTAACTGTCGACGGCGGCATAAGCTTCTCTAGCCAATCCCCAACACCGCGC
AATGCGGCTGGTCAGTCTTGCGCGCAAAAAGCGCAAGAACAAGACGAGGTCGACGGTGAAGATGCCATCGTGGGA
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACATCCCGGCCACAAGTTGCTACTACAAGCCGCTGTC
TTACTACTCAAAATCCCGAAAGTTGGCGAAGAGCCTTGCACAATCATCGTTGGTATCTCCAACAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAGGAGATGCAGTCATGGGACGAACGCGCCCGCGCTGTCATCGCCTTTCTTGCCACG
CAATTCAACACACCTACGACAGAAGCAGCCCAAGTTACGAGGTTAGAGGTCGATGGCGGCGATACGCCGACAATG
GAGCTTCGGGTCAACTTCTGTGACGGCACTGCGGACGTTCGCTGCGTCGACATCCGCGACCCATTCGGTCCCACC
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGAGAGACTCGTGAAGGCGGCAAGGCCATCAACAGTAGG
AGGACAGACCGTGGATGGCGAACGCTCGATATTTATGAGATTGATGTGCTGGATGCGACTCTGGCTGACGAAGAG
ATCGAAGGCAGCGAGGATCGGCAAAAGAAAAGGCATTCGGTAGCCGCGAATCCAGCAGCCAAAATCAGCAGCACT
GATTTCCGGAGGCGCAAAGCGGAGTCGCGAGCGCACGTCGGATAG
Gene >Ophcf2|04767
ATGGCCGGCCCTGTATCATCGCAAGAAATTGCTGGCATCCCCGCTCCAGCACTGCTCCTCCTGCCGTCACCTCCG
CAGCCCGCGACCCGAGCTCGCCTCCATGCCGCCTATCGCGTGCCTCTTACGGCCGTCCTCAAGCGGCTGAGCCGA
CAACGCACGCCTCAAACCCTCGTGGTCGCTGTTGCATCTTCTGTCCTGGTGCCGAGTCGCACTCAAGATTCGACC
GCAAGTGGAATATCGGCCGAGTCTACAGCTCCTTGCTCAGTCCGATGGCGATCCTCACAGGCGCTTCTCGCCGAT
ATCTACGCCTTGATAGCTTCTATTTGCGCCAGCCATAACCTCTCCCCTTACTCAGATAGCGAGAAACTGGCCGCC
GTCGATGCTCGCGTTGTCCTCATCCACCATCCTTCTAGCGCTGCGCTTGAAGCGCCGTTATCATCACGTCGTCGT
CTTTCTTCCGCCACGGCCTCAAAGAGCAGTGTTGTCCTAGACTTGGCTACCTTCGCCGCCACGGTTCGACCCTGG
AGTCTTTTCTTCCACATAAGCAGCGAGTCTGGCTACGAGCTGCTGGCAGACTACCTTGCCCATGCTGAGGGGCGA
CAACTGATCCTGCAAAGCCAGTTGGTAACTGTCGACGGCGGCATAAGCTTCTCTAGCCAATCCCCAACACCGCGC
AATGCGGCTGGTCAGTCTTGCGCGCAAAAAGCGCAAGAACAAGACGAGGTCGACGGTGAAGATGCCATCGTGGGA
TATAAAACTGTTTGCTTAGGCGGCACCTTTGATCACCTACATCCCGGCCACAAGTTGCTACTACAAGCCGCTGTC
TTACTACTCAAAATCCCGAAAGTTGGCGAAGAGCCTTGCACAATCATCGTTGGTATCTCCAACAGCGAGTTGCTC
GCCAAGAAGGAGTATGTGGAGGAGATGCAGTCATGGGACGAACGCGCCCGCGCTGTCATCGCCTTTCTTGCCACG
CAATTCAACACACCTACGACAGAAGCAGCCCAAGTTACGAGGTTAGAGGTCGATGGCGGCGATACGCCGACAATG
GAGCTTCGGGTCAACTTCTGTGACGGCACTGCGGACGTTCGCTGCGTCGACATCCGCGACCCATTCGGTCCCACC
ATATCCGAAGAGGCCATTGATGCTATCGTCGTCTCAGGAGAGACTCGTGAAGGCGGCAAGGCCATCAACAGTAGG
AGGACAGACCGTGGATGGCGAACGCTCGATATTTATGAGATTGATGTGCTGGATGCGACTCTGGCTGACGAAGAG
ATCGAAGGCAGCGAGGATCGGCAAAAGAAAAGGCATTCGGTAGCCGCGAATCCAGCAGCCAAAATCAGCAGCACT
GATTTCCGGAGGCGCAAAGCGGAGTCGCGAGCGCACGTCGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail