Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04765
Gene name
Locationscaffold_05:1533658..1535787
Strand-
Gene length (bp)2129
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7016 0.4389 0.0476 0.2682 0.0813 0.0225 0.1559 0.0451 0.0784 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5540
Ophiocordyceps australis map64 (Brazil) OphauB2|3771
Ophiocordyceps camponoti-floridani Ophcf2|04765 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|26
Ophiocordyceps kimflemingae Ophio5|5744
Ophiocordyceps subramaniannii Hirsu2|2380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04765
MPPNRTPIQPGVESSRSTSHPSEEEDSYQFDENNITDEEPEYEGDDYGLSPSDSASAVNERPPSRPRSGRSAARR
QRISRQEAQYAPLNSPSVESPDDFGGGYYGQSFQSVPPPRGGGGGGGGGYYNGRGHTSLPGYNHASHYMTGFHAG
GQMVPYNFGPNPFTPMSNHPSGASYFGAEPRPLYDVMPYQHNYYNPQQYLAPHMQQLSMAPGPAPATDVAPAKPA
SPAPPKEPPVDIEKIKRDAEEAARKLQEDRQKAINDQLEREAQIRKDAEESFQKRLEDARKQHEDAQKEIARAKA
EADRAAVERIQAEKKAEEERSRLQAEEMKRAEEKAIREYEAKAKAEEEKKKRELEERIRIEEAAKAQVHAILKAE
AEAKAAAEKKAAEDADRLKLIQEEAKLKAEIEAKAKVEAEKEAAKKAAEDEAAAKKEQEAMKKRIVDEAKAKFME
EASKNTEKGIINFKDAVGRKFNFPFALVKTWPGMEELIKQAFLHVEIIGPHVQEGHYDLTGPNGEIILPSIWEKV
IQPDWNISMTMWPVEKRPPLGGPKPLFRGRGGPAMPPPPPMGPPGMEPPPDWHPDRRRHSHMPNIEIVDMGPPPK
SRKPTAKKKPAGVLNFFAATSKPPPKKKASSKK*
Coding >Ophcf2|04765
ATGCCACCGAACAGGACCCCGATACAACCCGGTGTCGAGAGTTCACGCTCAACTTCCCATCCAAGCGAGGAAGAG
GACTCGTACCAATTTGACGAAAACAACATAACCGACGAGGAACCGGAATACGAAGGCGACGACTACGGGCTCTCT
CCCTCTGACTCTGCTTCCGCTGTCAACGAACGGCCACCATCGCGCCCGCGAAGCGGCAGGAGCGCGGCTCGCCGA
CAAAGAATTTCTCGACAGGAGGCGCAATACGCCCCGCTAAACTCGCCCAGCGTGGAGTCTCCCGACGATTTCGGC
GGCGGCTATTACGGCCAGTCGTTCCAATCTGTGCCCCCTCCGCGCGGTGGTGGTGGTGGTGGCGGCGGCGGCTAC
TACAACGGGCGTGGCCATACATCTTTGCCTGGGTACAACCATGCCAGCCATTACATGACGGGATTTCACGCTGGC
GGCCAGATGGTCCCCTACAATTTTGGCCCGAACCCTTTCACTCCCATGAGCAACCACCCGAGCGGCGCGAGCTAT
TTTGGGGCTGAGCCACGGCCCTTGTATGATGTGATGCCCTACCAGCACAACTACTACAACCCGCAGCAGTACTTG
GCTCCTCATATGCAACAGCTTTCAATGGCTCCGGGCCCGGCTCCGGCCACGGATGTGGCGCCTGCGAAGCCGGCC
AGTCCGGCACCCCCGAAGGAACCGCCTGTGGACATCGAAAAGATCAAGCGCGATGCCGAGGAGGCTGCCCGGAAG
CTGCAAGAGGATAGGCAGAAGGCCATTAACGATCAGCTCGAGCGGGAGGCGCAGATACGCAAGGATGCCGAGGAA
AGCTTCCAGAAGCGTCTGGAGGATGCGAGAAAGCAGCATGAGGATGCGCAGAAGGAAATCGCGCGCGCCAAGGCT
GAGGCCGACCGGGCCGCCGTGGAGAGGATCCAAGCCGAGAAGAAGGCTGAGGAGGAACGGTCACGTCTTCAGGCT
GAAGAAATGAAACGCGCCGAGGAAAAGGCGATTCGAGAGTACGAGGCCAAGGCCAAGGCGGAGGAGGAGAAAAAG
AAGAGGGAGTTGGAGGAGCGCATTAGGATTGAGGAAGCCGCAAAGGCTCAGGTCCACGCCATCTTAAAGGCCGAG
GCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAGGATGCTGACCGACTGAAACTGATACAGGAAGAGGCC
AAGCTCAAGGCCGAAATTGAAGCAAAGGCCAAGGTCGAGGCCGAAAAGGAAGCAGCCAAAAAAGCAGCCGAGGAC
GAAGCGGCAGCCAAGAAAGAGCAAGAGGCTATGAAGAAGCGTATTGTCGACGAGGCGAAAGCAAAGTTCATGGAG
GAAGCGTCCAAGAATACGGAGAAGGGAATCATCAACTTCAAGGATGCGGTCGGCAGAAAGTTCAACTTTCCCTTC
GCTCTCGTAAAAACCTGGCCGGGCATGGAGGAACTCATCAAGCAGGCCTTCCTCCACGTAGAGATCATCGGACCG
CACGTTCAAGAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTTCCGTCCATATGGGAAAAGGTG
ATACAGCCTGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGGCCGCCGCTGGGGGGTCCCAAGCCC
TTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCCGGGATGGAGCCGCCTCCG
GACTGGCACCCGGACAGACGGCGACATTCGCACATGCCCAACATTGAAATTGTCGACATGGGTCCGCCCCCCAAG
TCGAGGAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTGAATTTTTTCGCCGCCACTTCGAAACCACCACCT
AAGAAAAAAGCGAGCAGCAAGAAATAA
Transcript >Ophcf2|04765
ATGCCACCGAACAGGACCCCGATACAACCCGGTGTCGAGAGTTCACGCTCAACTTCCCATCCAAGCGAGGAAGAG
GACTCGTACCAATTTGACGAAAACAACATAACCGACGAGGAACCGGAATACGAAGGCGACGACTACGGGCTCTCT
CCCTCTGACTCTGCTTCCGCTGTCAACGAACGGCCACCATCGCGCCCGCGAAGCGGCAGGAGCGCGGCTCGCCGA
CAAAGAATTTCTCGACAGGAGGCGCAATACGCCCCGCTAAACTCGCCCAGCGTGGAGTCTCCCGACGATTTCGGC
GGCGGCTATTACGGCCAGTCGTTCCAATCTGTGCCCCCTCCGCGCGGTGGTGGTGGTGGTGGCGGCGGCGGCTAC
TACAACGGGCGTGGCCATACATCTTTGCCTGGGTACAACCATGCCAGCCATTACATGACGGGATTTCACGCTGGC
GGCCAGATGGTCCCCTACAATTTTGGCCCGAACCCTTTCACTCCCATGAGCAACCACCCGAGCGGCGCGAGCTAT
TTTGGGGCTGAGCCACGGCCCTTGTATGATGTGATGCCCTACCAGCACAACTACTACAACCCGCAGCAGTACTTG
GCTCCTCATATGCAACAGCTTTCAATGGCTCCGGGCCCGGCTCCGGCCACGGATGTGGCGCCTGCGAAGCCGGCC
AGTCCGGCACCCCCGAAGGAACCGCCTGTGGACATCGAAAAGATCAAGCGCGATGCCGAGGAGGCTGCCCGGAAG
CTGCAAGAGGATAGGCAGAAGGCCATTAACGATCAGCTCGAGCGGGAGGCGCAGATACGCAAGGATGCCGAGGAA
AGCTTCCAGAAGCGTCTGGAGGATGCGAGAAAGCAGCATGAGGATGCGCAGAAGGAAATCGCGCGCGCCAAGGCT
GAGGCCGACCGGGCCGCCGTGGAGAGGATCCAAGCCGAGAAGAAGGCTGAGGAGGAACGGTCACGTCTTCAGGCT
GAAGAAATGAAACGCGCCGAGGAAAAGGCGATTCGAGAGTACGAGGCCAAGGCCAAGGCGGAGGAGGAGAAAAAG
AAGAGGGAGTTGGAGGAGCGCATTAGGATTGAGGAAGCCGCAAAGGCTCAGGTCCACGCCATCTTAAAGGCCGAG
GCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAGGATGCTGACCGACTGAAACTGATACAGGAAGAGGCC
AAGCTCAAGGCCGAAATTGAAGCAAAGGCCAAGGTCGAGGCCGAAAAGGAAGCAGCCAAAAAAGCAGCCGAGGAC
GAAGCGGCAGCCAAGAAAGAGCAAGAGGCTATGAAGAAGCGTATTGTCGACGAGGCGAAAGCAAAGTTCATGGAG
GAAGCGTCCAAGAATACGGAGAAGGGAATCATCAACTTCAAGGATGCGGTCGGCAGAAAGTTCAACTTTCCCTTC
GCTCTCGTAAAAACCTGGCCGGGCATGGAGGAACTCATCAAGCAGGCCTTCCTCCACGTAGAGATCATCGGACCG
CACGTTCAAGAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTTCCGTCCATATGGGAAAAGGTG
ATACAGCCTGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGGCCGCCGCTGGGGGGTCCCAAGCCC
TTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCCGGGATGGAGCCGCCTCCG
GACTGGCACCCGGACAGACGGCGACATTCGCACATGCCCAACATTGAAATTGTCGACATGGGTCCGCCCCCCAAG
TCGAGGAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTGAATTTTTTCGCCGCCACTTCGAAACCACCACCT
AAGAAAAAAGCGAGCAGCAAGAAATAA
Gene >Ophcf2|04765
ATGCCGTGAGTTTTCTCATAATCCTTCCCGTCCTTTGAGAGGGGGCGTGCATATCGCAGTCTCACTCGCCGTCTC
AACCCACTACCACTGACAAGACTATTCCGAAGACCGAACAGGACCCCGATACAACCCGGTGTCGAGAGTTCACGC
TCAACTTCCCATCCAAGCGAGGAAGAGGACTCGTACCAATTTGACGAAAACAACATAACCGACGAGGAACCGGAA
TACGAAGGCGACGACTACGGGCTCTCTCCCTCTGACTCTGCTTCCGCTGTCAACGAACGGCCACCATCGCGCCCG
CGAAGCGGCAGGAGCGCGGCTCGCCGACAAAGAATTTCTCGACAGGAGGCGCAATACGCCCCGCTAAACTCGCCC
AGCGTGGAGTCTCCCGACGATTTCGGCGGCGGCTATTACGGCCAGTCGTTCCAATCTGTGCCCCCTCCGCGCGGT
GGTGGTGGTGGTGGCGGCGGCGGCTACTACAACGGGCGTGGCCATACATCTTTGCCTGGGTACAACCATGCCAGC
CATTACATGACGGGATTTCACGCTGGCGGCCAGATGGTCCCCTACAATTTTGGCCCGAACCCTTTCACTCCCATG
AGCAACCACCCGAGCGGCGCGAGCTATTTTGGGGCTGAGCCACGGCCCTTGTATGATGTGATGCCCTACCAGCAC
AACTACTACAACCCGCAGCAGTACTTGGCTCCTCATATGCAACAGCTTTCAATGGCTCCGGGCCCGGCTCCGGCC
ACGGATGTGGCGCCTGCGAAGCCGGCCAGTCCGGCACCCCCGAAGGAACCGCCTGTGGACATCGAAAAGATCAAG
CGCGATGCCGAGGAGGCTGCCCGGAAGCTGCAAGAGGATAGGCAGAAGGCCATTAACGATCAGCTCGAGCGGGAG
GCGCAGATACGCAAGGATGCCGAGGAAAGCTTCCAGAAGCGTCTGGAGGATGCGAGAAAGCAGCATGAGGATGCG
CAGAAGGAAATCGCGCGCGCCAAGGCTGAGGCCGACCGGGCCGCCGTGGAGAGGATCCAAGCCGAGAAGAAGGCT
GAGGAGGAACGGTCACGTCTTCAGGCTGAAGAAATGAAACGCGCCGAGGAAAAGGCGATTCGAGAGTACGAGGCC
AAGGCCAAGGCGGAGGAGGAGAAAAAGAAGAGGGAGTTGGAGGAGCGCATTAGGATTGAGGAAGCCGCAAAGGCT
CAGGTCCACGCCATCTTAAAGGCCGAGGCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAGGATGCTGAC
CGACTGAAACTGATACAGGAAGAGGCCAAGCTCAAGGCCGAAATTGAAGCAAAGGCCAAGGTCGAGGCCGAAAAG
GAAGCAGCCAAAAAAGCAGCCGAGGACGAAGCGGCAGCCAAGAAAGAGCAAGAGGCTATGAAGAAGCGTATTGTC
GACGAGGCGAAAGCAAAGTTCATGGAGGAAGCGTCCAAGAATACGGAGAAGGGAATCATCAACTTCAAGGATGCG
GTCGGCAGAAAGTTCAACTTTCCCTTCGCTCTCGTAAAAACCTGGCCGGTACGTGTGTCGCAGCTTGACATTGAA
CTTTCATGAGCGTATGCTGACCTAGATGGATCTGCATAGGGCATGGAGGAACTCATCAAGCAGGCCTTCCTCCAC
GTAGAGATCATCGGACCGCACGTTCAAGAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTTCCG
TCCATATGGGAAAAGGTGATACAGCCTGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGGCCGCCG
CTGGGGGGTCCCAAGCCCTTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCC
GGGATGGAGCCGCCTCCGGACTGGCACCCGGACAGACGGCGACATTCGCACATGCCCAACATTGAAATTGTCGAC
ATGGGTCCGCCCCCCAAGTCGAGGAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTGAATTTTTTCGCCGCC
ACTTCGAAACCACCACCTAAGAAAAAGTGAGGAAATTGCTACACCTGTCGTGTCCGGGCTCATGCTGACGACGTG
CTTTTTGTAGAGCGAGCAGCAAGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail