Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04763
Gene name
Locationscaffold_05:1527291..1528277
Strand+
Gene length (bp)986
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 1.1E-46 46 194

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0019538 protein metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016859 cis-trans isomerase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0018208 peptidyl-proline modification No
GO:0043412 macromolecule modification No
GO:0008150 biological_process No
GO:0016853 isomerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 220 242 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 491.67 256.14 727.20
Alive In ants, during behavior modification 621.47 292.41 950.52
Dead In ants, recently dead 372.63 199.21 546.06

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.307116 no
Alive Dead 0.004828 yes
Dead Fungus 0.190441 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04763
MLNLRKLLTSAVLVSGVGLLLLAQSAEAGKGPKITHKVTFHMKHGDEDIGSIVMGLYGNTVPKTVDNFFELAQKK
SGAGYLDSTFHRVIEKFMIQGGDFTKGDGTGGKSIYGEKFADENFKLKHSKPGILSMANSGKDTNGSQFFITTVI
TSWLDGRHVVFGEVIDGFDVVTQIEHVPVDGSSKPIKPVRVAKVDTERLLEEADAREDEPTTLPQDENYTGWSSV
QKLIVFGVAVGAVVIYLRSRKQYSRMD*
Coding >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCATCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGC
AAGCCGGGCATCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATC
ACTTCGTGGCTCGACGGACGTCATGTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAG
CATGTCCCCGTCGATGGCAGCAGCAAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTC
GAAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTGTG
CAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGAGG
ATGGATTAG
Transcript >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCATCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGC
AAGCCGGGCATCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATC
ACTTCGTGGCTCGACGGACGTCATGTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAG
CATGTCCCCGTCGATGGCAGCAGCAAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTC
GAAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTGTG
CAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGAGG
ATGGATTAG
Gene >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCAGTATGTGGTGCAGAACCCATTTCATGAGCTTTCGGTTCTTTGAGCTG
ACGCGCTGACCTTTCTAGTCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGCAAGCCGGGCA
TCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATCACTTCGTACG
CTCCGTCATACTTCGCGCCTTCGCGATGTCATTGGCTAATGAACGAAACTCTACAGGTGGCTCGACGGACGTCAT
GTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAGCATGTCCCCGTCGATGGCAGCAGC
AAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTCGAAGGTACACACAAAGAACTTTAG
AGACATCGCGCGCTACCGGGCAAATCATTCTTATCGCTATGGCCGATATGCTGATTGGCGTGGCACCGCCCTTTC
TTACAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTG
TGCAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGA
GGATGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail