Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04763
Gene name
Locationscaffold_05:1527291..1528277
Strand+
Gene length (bp)986
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 1.1E-46 46 194

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0019538 protein metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016859 cis-trans isomerase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0018208 peptidyl-proline modification No
GO:0043412 macromolecule modification No
GO:0008150 biological_process No
GO:0016853 isomerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 220 242 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04763
MLNLRKLLTSAVLVSGVGLLLLAQSAEAGKGPKITHKVTFHMKHGDEDIGSIVMGLYGNTVPKTVDNFFELAQKK
SGAGYLDSTFHRVIEKFMIQGGDFTKGDGTGGKSIYGEKFADENFKLKHSKPGILSMANSGKDTNGSQFFITTVI
TSWLDGRHVVFGEVIDGFDVVTQIEHVPVDGSSKPIKPVRVAKVDTERLLEEADAREDEPTTLPQDENYTGWSSV
QKLIVFGVAVGAVVIYLRSRKQYSRMD*
Coding >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCATCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGC
AAGCCGGGCATCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATC
ACTTCGTGGCTCGACGGACGTCATGTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAG
CATGTCCCCGTCGATGGCAGCAGCAAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTC
GAAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTGTG
CAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGAGG
ATGGATTAG
Transcript >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCATCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGC
AAGCCGGGCATCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATC
ACTTCGTGGCTCGACGGACGTCATGTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAG
CATGTCCCCGTCGATGGCAGCAGCAAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTC
GAAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTGTG
CAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGAGG
ATGGATTAG
Gene >Ophcf2|04763
ATGTTGAATCTGAGAAAGTTGCTAACCTCAGCCGTCCTCGTATCCGGGGTCGGTCTGCTGCTCTTGGCCCAAAGC
GCCGAGGCTGGCAAAGGTCCCAAGATCACCCACAAGGTGACTTTTCATATGAAGCATGGCGACGAGGACATTGGA
TCCATCGTCATGGGTCTTTACGGGAATACGGTGCCCAAGACGGTGGATAATTTCTTTGAACTTGCACAGAAGAAG
TCGGGTGCAGGCTATCTCGACTCGACATTCCATCGCGTCATCGAAAAGTTCATGATTCAGGGTGGCGATTTCACC
AAAGGCGATGGCACGGGTGGCAAATCCAGTATGTGGTGCAGAACCCATTTCATGAGCTTTCGGTTCTTTGAGCTG
ACGCGCTGACCTTTCTAGTCTATGGCGAAAAGTTCGCCGACGAAAACTTCAAGCTGAAGCACAGCAAGCCGGGCA
TCCTGTCCATGGCCAACTCTGGAAAGGACACCAACGGCTCGCAATTCTTCATCACTACCGTCATCACTTCGTACG
CTCCGTCATACTTCGCGCCTTCGCGATGTCATTGGCTAATGAACGAAACTCTACAGGTGGCTCGACGGACGTCAT
GTCGTCTTCGGCGAAGTCATCGACGGCTTCGACGTCGTCACGCAGATCGAGCATGTCCCCGTCGATGGCAGCAGC
AAGCCGATAAAACCCGTCCGCGTCGCCAAGGTCGACACCGAACGTCTTCTCGAAGGTACACACAAAGAACTTTAG
AGACATCGCGCGCTACCGGGCAAATCATTCTTATCGCTATGGCCGATATGCTGATTGGCGTGGCACCGCCCTTTC
TTACAGAAGCCGACGCCCGAGAGGACGAACCGACGACACTTCCGCAGGACGAGAACTATACAGGCTGGTCGTCTG
TGCAAAAGCTCATCGTGTTTGGTGTTGCTGTTGGCGCTGTGGTCATATATCTGCGGAGCAGGAAACAGTACTCGA
GGATGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail