Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04759
Gene name
Locationscaffold_05:1519439..1520426
Strand+
Gene length (bp)987
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20520 Ac45-VOA1_TM V0 complex accessory subunit Ac45/VOA1 transmembrane domain 1.1E-17 222 261

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 227 249 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 241.97 134.99 348.94
Alive In ants, during behavior modification 294.37 161.50 427.24
Dead In ants, recently dead 315.88 171.33 460.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.348521 no
Alive Dead 0.731073 no
Dead Fungus 0.184920 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04759
MRLRTVVEILAFSLSAAALSDSFPLLLLSTAKFHDVPNRNQFQTSDEALKYVRGVLATCPTNRYLIATQPGIHAS
DFRQANGCAMPRLCRAAAKPQIKSEFSVAEVFGDTEYAGFSQHIESECAKKGKAVIVDEVHLPPLSSRDRASDLL
KHDMILSDSFEAVTKNDDYTILFLPRPGEPAYQAEFIDPLHQDLKRDFEPELVRRDDNDTAWQRLPLFEKYQFFT
PGIFTGIIVALVLFSILGVGLSALSSLEVSYGAFEKDMGPAAQKKQQ*
Coding >Ophcf2|04759
ATGCGTCTTCGTACAGTTGTCGAAATTCTAGCGTTTTCGCTTTCGGCAGCGGCGCTGTCGGATTCATTTCCGCTT
CTGCTCCTTTCCACGGCAAAGTTTCACGATGTTCCCAACCGCAACCAGTTTCAGACGAGCGACGAGGCGTTGAAA
TACGTCAGAGGGGTGCTGGCGACGTGCCCTACGAACCGTTATCTTATTGCCACGCAGCCGGGAATCCATGCCTCC
GACTTTCGTCAGGCCAACGGGTGCGCCATGCCCCGTCTTTGCCGAGCGGCCGCGAAGCCGCAGATCAAGAGCGAA
TTTTCTGTCGCTGAAGTGTTTGGGGATACGGAATACGCTGGGTTCTCTCAGCATATTGAGTCGGAGTGCGCCAAG
AAGGGCAAGGCCGTCATCGTCGACGAGGTTCATTTGCCGCCCTTGAGCAGCAGAGACAGGGCCAGCGACTTGCTC
AAGCATGACATGATCCTTTCCGACAGCTTCGAGGCCGTCACCAAGAACGACGACTACACCATTCTTTTCCTACCG
AGACCGGGCGAGCCCGCGTATCAAGCCGAATTTATCGATCCGCTACACCAAGATCTGAAGAGAGATTTCGAGCCG
GAGCTGGTGCGTCGCGACGATAACGACACCGCATGGCAGCGCCTCCCGCTATTTGAAAAGTACCAATTCTTCACC
CCTGGCATTTTCACGGGGATTATTGTAGCCCTGGTACTCTTTTCGATTCTCGGTGTCGGACTCAGCGCGTTGTCG
AGCTTGGAGGTATCGTATGGCGCTTTTGAGAAGGACATGGGCCCTGCTGCTCAGAAGAAGCAGCAGTGA
Transcript >Ophcf2|04759
ATGCGTCTTCGTACAGTTGTCGAAATTCTAGCGTTTTCGCTTTCGGCAGCGGCGCTGTCGGATTCATTTCCGCTT
CTGCTCCTTTCCACGGCAAAGTTTCACGATGTTCCCAACCGCAACCAGTTTCAGACGAGCGACGAGGCGTTGAAA
TACGTCAGAGGGGTGCTGGCGACGTGCCCTACGAACCGTTATCTTATTGCCACGCAGCCGGGAATCCATGCCTCC
GACTTTCGTCAGGCCAACGGGTGCGCCATGCCCCGTCTTTGCCGAGCGGCCGCGAAGCCGCAGATCAAGAGCGAA
TTTTCTGTCGCTGAAGTGTTTGGGGATACGGAATACGCTGGGTTCTCTCAGCATATTGAGTCGGAGTGCGCCAAG
AAGGGCAAGGCCGTCATCGTCGACGAGGTTCATTTGCCGCCCTTGAGCAGCAGAGACAGGGCCAGCGACTTGCTC
AAGCATGACATGATCCTTTCCGACAGCTTCGAGGCCGTCACCAAGAACGACGACTACACCATTCTTTTCCTACCG
AGACCGGGCGAGCCCGCGTATCAAGCCGAATTTATCGATCCGCTACACCAAGATCTGAAGAGAGATTTCGAGCCG
GAGCTGGTGCGTCGCGACGATAACGACACCGCATGGCAGCGCCTCCCGCTATTTGAAAAGTACCAATTCTTCACC
CCTGGCATTTTCACGGGGATTATTGTAGCCCTGGTACTCTTTTCGATTCTCGGTGTCGGACTCAGCGCGTTGTCG
AGCTTGGAGGTATCGTATGGCGCTTTTGAGAAGGACATGGGCCCTGCTGCTCAGAAGAAGCAGCAGTGA
Gene >Ophcf2|04759
ATGCGTCTTCGTACAGTTGTCGAAATTCTAGCGTTTTCGCTTTCGGCAGCGGCGCTGTCGGATTCATTTCCGCTT
CTGCTCCTTTCCACGGCAAAGTAGGCATTCCGGGCCCGACGGCCAGCTCGCCTCCTGACTTCCTCGCAACTAACC
TTGACCAGGTTTCACGATGTTCCCAACCGCAACCAGTTTCAGACGAGCGACGAGGCGTTGAAATACGTCAGAGGG
GTGCTGGCGACGTGCCCTACGAACCGTTATCTTATTGCCACGCAGCCGGGAATCCATGCCTCCGACTTTCGTCAG
GCCAACGGGTGCGCCATGCCCCGTCTTTGCCGAGCGGCCGCGAAGCCGCAGATCAAGAGCGAATTTTCTGTCGCT
GAAGTGTTTGGGGATACGGAATACGCTGGGTTCTCTCAGCATATTGAGTCGGAGTGCGCCAAGAAGGGCAAGGCC
GTCATCGTCGACGAGGTTCATTTGCCGCCCTTGAGCAGCAGAGACAGGGCCAGCGACTTGCTCAAGCATGGTGAA
TTTACCCACACAATCCGTTGGGTATCCAGTGGGCTTACTCCGTGATAATAGACATGATCCTTTCCGACAGCTTCG
AGGCCGTCACCAAGAACGACGACTACACCATTCTTTTCCTACCGAGACCGGGCGAGCCCGCGTATCAAGCCGAAT
TTATCGATCCGCTACACCAAGATCTGAAGAGAGATTTCGAGCCGGAGCTGGTGCGTCGCGACGATAACGACACCG
CATGGCAGCGCCTCCCGCTATTTGAAAAGTACCAATTCTTCACCCCTGGTATTACCTCTTCCTCGCCCTCTTTAC
CCCTCGACCTAACCTCCTCCAGGCATTTTCACGGGGATTATTGTAGCCCTGGTACTCTTTTCGATTCTCGGTGTC
GGACTCAGCGCGTTGTCGAGCTTGGAGGTATCGTATGGCGCTTTTGAGAAGGACATGGGCCCTGCTGCTCAGAAG
AAGCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail