Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04757
Gene name
Locationscaffold_05:1517578..1518265
Strand+
Gene length (bp)687
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12718 Tropomyosin_1 Tropomyosin like 2.3E-44 7 149

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.748 0.3642 0.0462 0.1588 0.1469 0.002 0.1126 0.1512 0.2033 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4949
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6495
Ophiocordyceps camponoti-floridani Ophcf2|04757 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|18
Ophiocordyceps kimflemingae Ophio5|5754
Ophiocordyceps subramaniannii Hirsu2|1878

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04757
MDRIKEKMNALRLEADESANKVEELQSKVKVLDQENLSREQEITSLKHKNTLLEAENEKLEAAIKETKKAADEGQ
QHGTQNETLQRRVQLLEDEAEEADKTIRECKEMLRQSDLKCGQLERKVQALESERDQWEQKYEGKETEFAALKKE
LDELQHEIGNI*
Coding >Ophcf2|04757
ATGGATCGCATCAAGGAGAAAATGAACGCCCTCCGCCTTGAGGCCGATGAATCTGCCAATAAGGTCGAGGAACTG
CAGAGCAAGGTCAAGGTGCTCGATCAGGAGAATTTGTCGAGGGAACAGGAAATCACCTCCCTCAAGCACAAAAAC
ACCCTGCTCGAGGCCGAGAACGAGAAGCTCGAGGCTGCCATCAAGGAAACGAAAAAGGCCGCAGACGAGGGTCAA
CAACACGGCACTCAGAACGAGACGCTGCAGCGGCGCGTGCAGCTGCTCGAGGACGAAGCCGAGGAAGCCGACAAG
ACCATCCGCGAGTGCAAGGAGATGCTTCGTCAATCCGACCTCAAGTGCGGCCAACTGGAGCGAAAGGTACAGGCG
CTCGAGAGCGAGCGCGATCAATGGGAGCAGAAGTACGAGGGCAAGGAGACAGAATTCGCTGCCCTCAAGAAGGAG
CTGGACGAGCTGCAGCACGAAATCGGCAACATCTGA
Transcript >Ophcf2|04757
ATGGATCGCATCAAGGAGAAAATGAACGCCCTCCGCCTTGAGGCCGATGAATCTGCCAATAAGGTCGAGGAACTG
CAGAGCAAGGTCAAGGTGCTCGATCAGGAGAATTTGTCGAGGGAACAGGAAATCACCTCCCTCAAGCACAAAAAC
ACCCTGCTCGAGGCCGAGAACGAGAAGCTCGAGGCTGCCATCAAGGAAACGAAAAAGGCCGCAGACGAGGGTCAA
CAACACGGCACTCAGAACGAGACGCTGCAGCGGCGCGTGCAGCTGCTCGAGGACGAAGCCGAGGAAGCCGACAAG
ACCATCCGCGAGTGCAAGGAGATGCTTCGTCAATCCGACCTCAAGTGCGGCCAACTGGAGCGAAAGGTACAGGCG
CTCGAGAGCGAGCGCGATCAATGGGAGCAGAAGTACGAGGGCAAGGAGACAGAATTCGCTGCCCTCAAGAAGGAG
CTGGACGAGCTGCAGCACGAAATCGGCAACATCTGA
Gene >Ophcf2|04757
ATGGATCGCATCAAGGAGGTTCGTCCCATAAGCTGAGGAGCTCCTCAACCCCTCGCCCGCATCCTGCCCCTGTGC
CCTGCTAAGAACGATACTGACTGTGGCGCGCAGAAAATGAACGCCCTCCGCCTTGAGGCCGATGAATCTGCCAAT
AAGGTCGAGGAACTGCAGAGCAAGGTCAAGGTGCTCGATCAGGAGAATTTGTCGAGGGAACAGGAAATCACCTCC
CTCAAGCACAAAAACACCCTGCTCGAGGCCGAGAACGAGAAGCTCGAGGCTGCCATCAAGGAAACGAAAAAGGCC
GCAGACGAGGGTCAACAACACGGCACTCAGAACGAGACGCTGCAGCGGCGCGTGCAGCTGCTCGAGGACGAAGCC
GAGGAAGCCGACAAGACCATCCGCGAGTGCAAGGAGATGTACGTGACTGCTCGGGGATTCACACACTCTTACTAC
TCTTACTTCCCCTCTCCCCCCTCTCATCTGACCCCTCTTCCCTGAGTCTCACGATACTAACAGCGTCCGCATAGG
CTTCGTCAATCCGACCTCAAGTGCGGCCAACTGGAGCGAAAGGTACAGGCGCTCGAGAGCGAGCGCGATCAATGG
GAGCAGAAGTACGAGGGCAAGGAGACAGAATTCGCTGCCCTCAAGAAGGAGCTGGACGAGCTGCAGCACGAAATC
GGCAACATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail