Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04750
Gene name
Locationscaffold_05:1494306..1497831
Strand+
Gene length (bp)3525
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 4.1E-34 312 452
PF02460 Patched Patched family 6.8E-09 308 445

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 288 307 19
3 320 342 22
4 420 442 22
5 485 507 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 59.04 32.44 85.64
Alive In ants, during behavior modification 43.58 24.48 62.69
Dead In ants, recently dead 48.17 26.84 69.49

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.119127 no
Alive Dead 0.598085 no
Dead Fungus 0.330480 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04750
MIWYLLYPLRGTTEAPVLPSSHPLHSAFARYGRYAARHVVATLLVSAAVATVLVYPIPFLFTSDFVNGASNLPRH
VWTVAQPLAYDAAKEPDIIMRSIWVHASYMKALNTELLVSALQLQDDLLGITKNFSPASARHEPPWNDLPDPDLS
LTQRNAIHVANGLTSQSWFFHSPLLYWGCSRERILADDDILSTVNNKKNQSTFANITLRHSIVFSGKRFQERRLL
AADSLVITLLHLDDSPVGRRWERQALELPKKAGDKWNIYPPDGRAASSQLYEFQFRPISMQDIASLALAYGLTLV
YFLKTLSTLRAVKSRAGLMVTVLAQIMFSIMSSFTVCAIFNVDLSRIPRAAYPLVVLAMSLEHIFRLINAVLLTP
LEDVVSNRIGKAFAETAPTAMFSTLQNVVLLSGLSHLVSAGVSGFCAFAAIAIVFDFFYLSTFFLAVLSVDVRRI
ELGEALAKASMRHNCDLRVGRRSWWGPVLQGRIALSTRIAGTIIMFGFVLIAQWHFFGDEGLFRKLVRFYGDSDR
GQGPGPSMSSLLDSLHQARSPTSWLRIQDHETAREVISIIKPSSYSYVARVFDPIVFVLKNSDRVPPRKEPPLLP
AAYDFIRHELFRFLVVVVVVIAALRLLTNFLLWEDEDINGKHESDELPRLSVKSLARGHLMDVVLLTTSADGHVV
SVGLDNTIRAWSVKGIGTSYVIARGDQPQTSVFPVVAMAIDDDSRWLVVMSRLKRDVSSSVSFSFWDLQSRRWGS
SIQANNCRHRPVALLLDPSTPSDQPRALVIQQDARDGGDSPPRPIILAISRQGEVHMATRDNGVWTRRRLAIEKL
DETGPHSIQVVAMLNLFVVAGGNCAHLIDGKDGGVLQTLRTAKMLPRPLRCAYTRHGSSQPESMGLASFTLGYVE
ADSRDCILQTYVPSEDCDAIYLRTPCEARTNNWCTWESARETRKRVADPGVWEMVSDGSAVGIRFDRPVGKKYQV
KAMSGLRNRYGKREAEPDPFEGWQVWMESSPGCRHEESESHRLIKDGEQAGHLLVTEVGPKARVGLNSVAFAFGD
MIKLVIVGSKVRLKERSEGRAGETLMMSAGGRRRKPASLLRGRVAS*
Coding >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCAC
AGCGCTTTTGCTCGCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCC
ACCGTTCTCGTCTATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCAT
GTCTGGACGGTCGCCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTG
CATGCCAGCTATATGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGC
ATTACAAAGAACTTCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCT
CTGACCCAAAGAAATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTG
TACTGGGGTTGCAGTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAG
TCCACATTCGCCAACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTG
GCCGCCGATTCGCTCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCC
TTAGAGCTGCCCAAAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTC
TACGAGTTCCAATTCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTC
TACTTCCTCAAAACTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAA
ATCATGTTCTCCATCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCA
GCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCC
TTGGAGGATGTTGTGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTG
CAGAACGTCGTTCTTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCC
ATTGCCATTGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATA
GAGCTCGGCGAGGCACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGG
GGCCCGGTCTTGCAAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTC
ATCGCACAGTGGCACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGA
GGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTG
CGCATACAGGATCACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGC
GTCTTCGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCG
GCAGCTTACGATTTCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGC
CTGTTGACCAACTTCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTG
TCCGTCAAGTCATTGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTG
TCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGC
GATCAACCCCAGACTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATG
TCGAGGCTTAAGCGAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCG
TCGATCCAGGCCAACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCG
AGGGCGCTCGTCATCCAACAGGACGCCAGAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTGGCAATATCG
AGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATCGAAAAACTG
GATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGCAACTGTGCC
CATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGG
TGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGCTACGTGGAA
GCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTGCGGACGCCG
TGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGT
GTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAATATCAGGTC
AAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGCTGGCAGGTG
TGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGCGAGCAGGCT
GGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCGTTTGGCGAC
ATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGCGAGACACTG
ATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Transcript >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCAC
AGCGCTTTTGCTCGCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCC
ACCGTTCTCGTCTATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCAT
GTCTGGACGGTCGCCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTG
CATGCCAGCTATATGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGC
ATTACAAAGAACTTCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCT
CTGACCCAAAGAAATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTG
TACTGGGGTTGCAGTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAG
TCCACATTCGCCAACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTG
GCCGCCGATTCGCTCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCC
TTAGAGCTGCCCAAAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTC
TACGAGTTCCAATTCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTC
TACTTCCTCAAAACTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAA
ATCATGTTCTCCATCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCA
GCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCC
TTGGAGGATGTTGTGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTG
CAGAACGTCGTTCTTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCC
ATTGCCATTGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATA
GAGCTCGGCGAGGCACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGG
GGCCCGGTCTTGCAAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTC
ATCGCACAGTGGCACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGA
GGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTG
CGCATACAGGATCACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGC
GTCTTCGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCG
GCAGCTTACGATTTCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGC
CTGTTGACCAACTTCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTG
TCCGTCAAGTCATTGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTG
TCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGC
GATCAACCCCAGACTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATG
TCGAGGCTTAAGCGAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCG
TCGATCCAGGCCAACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCG
AGGGCGCTCGTCATCCAACAGGACGCCAGAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTGGCAATATCG
AGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATCGAAAAACTG
GATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGCAACTGTGCC
CATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGG
TGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGCTACGTGGAA
GCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTGCGGACGCCG
TGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGT
GTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAATATCAGGTC
AAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGCTGGCAGGTG
TGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGCGAGCAGGCT
GGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCGTTTGGCGAC
ATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGCGAGACACTG
ATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Gene >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGTGAGAAACACCCCCATCTTTTCCACCTCAGGCTTGAGCTGAC
TTCCTTCTCCCATCTCTAGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCACAGCGCTTTTGCTC
GCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCCACCGTTCTCGTCT
ATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCATGTCTGGACGGTCG
CCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTGCATGCCAGCTATA
TGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGCATTACAAAGAACT
TCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCTCTGACCCAAAGAA
ATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTGTACTGGGGTTGCA
GTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAGTCCACATTCGCCA
ACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTGGCCGCCGATTCGC
TCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCCTTAGAGCTGCCCA
AAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTCTACGAGTTCCAAT
TCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTCTACTTCCTCAAAA
CTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAAATCATGTTCTCCA
TCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCAGCATACCCCCTAG
TAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCCTTGGAGGATGTTG
TGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTGCAGAACGTCGTTC
TTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCCATTGCCATTGTCT
TCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATAGAGCTCGGCGAGG
CACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGGGGCCCGGTCTTGC
AAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTCATCGCACAGTGGC
ACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGAGGCCAGGGTCCAG
GCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTGCGCATACAGGATC
ACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGCGTCTTCGATCCGA
TCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCGGCAGCTTACGATT
TCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGCCTGTTGACCAACT
TCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTGTCCGTCAAGTCAT
TGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTGTCCGTCGGGCTCG
ATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGCGATCAACCCCAGA
CTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATGTCGAGGCTTAAGC
GAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCGTCGATCCAGGCCA
ACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCGAGGGCGCTCGTCA
TCCAACAGGACGGTTCGTTGATTGAGATATTGCCAGGCGGCGAGCAGGCGAAGCCACGACCTACTCCCTTATTTC
CTCGACACCTGACATGTGCTCGCTTGCTAGCCAGAGGTAAACCACCCCCAATTAAGCTCTCGGTCGTTGGCGTTG
GTCGCAGCAGAGGGCGCTAATAATCATATCATCGCTCTAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTG
GCAATATCGAGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATC
GAAAAACTGGATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGC
AACTGTGCCCATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGG
CCTTTGAGGTGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGC
TACGTGGAAGCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTG
CGGACGCCGTGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCG
GACCCCGGTGTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAA
TATCAGGTCAAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGC
TGGCAGGTGTGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGC
GAGCAGGCTGGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCG
TTTGGCGACATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGC
GAGACACTGATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail