Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04750
Gene name
Locationscaffold_05:1494306..1497831
Strand+
Gene length (bp)3525
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 4.1E-34 312 452
PF02460 Patched Patched family 6.8E-09 308 445

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Golgi apparatus Signal peptide|Transmembrane domain 0.0975 0.1931 0.0208 0.2911 0.0909 0.1825 0.8099 0.3747 0.6812 0.2675

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 288 307 19
3 320 342 22
4 420 442 22
5 485 507 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2469
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7567
Ophiocordyceps australis map64 (Brazil) OphauB2|3748
Ophiocordyceps camponoti-floridani Ophcf2|04750 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|11
Ophiocordyceps kimflemingae Ophio5|5340
Ophiocordyceps subramaniannii Hirsu2|3550

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04750
MIWYLLYPLRGTTEAPVLPSSHPLHSAFARYGRYAARHVVATLLVSAAVATVLVYPIPFLFTSDFVNGASNLPRH
VWTVAQPLAYDAAKEPDIIMRSIWVHASYMKALNTELLVSALQLQDDLLGITKNFSPASARHEPPWNDLPDPDLS
LTQRNAIHVANGLTSQSWFFHSPLLYWGCSRERILADDDILSTVNNKKNQSTFANITLRHSIVFSGKRFQERRLL
AADSLVITLLHLDDSPVGRRWERQALELPKKAGDKWNIYPPDGRAASSQLYEFQFRPISMQDIASLALAYGLTLV
YFLKTLSTLRAVKSRAGLMVTVLAQIMFSIMSSFTVCAIFNVDLSRIPRAAYPLVVLAMSLEHIFRLINAVLLTP
LEDVVSNRIGKAFAETAPTAMFSTLQNVVLLSGLSHLVSAGVSGFCAFAAIAIVFDFFYLSTFFLAVLSVDVRRI
ELGEALAKASMRHNCDLRVGRRSWWGPVLQGRIALSTRIAGTIIMFGFVLIAQWHFFGDEGLFRKLVRFYGDSDR
GQGPGPSMSSLLDSLHQARSPTSWLRIQDHETAREVISIIKPSSYSYVARVFDPIVFVLKNSDRVPPRKEPPLLP
AAYDFIRHELFRFLVVVVVVIAALRLLTNFLLWEDEDINGKHESDELPRLSVKSLARGHLMDVVLLTTSADGHVV
SVGLDNTIRAWSVKGIGTSYVIARGDQPQTSVFPVVAMAIDDDSRWLVVMSRLKRDVSSSVSFSFWDLQSRRWGS
SIQANNCRHRPVALLLDPSTPSDQPRALVIQQDARDGGDSPPRPIILAISRQGEVHMATRDNGVWTRRRLAIEKL
DETGPHSIQVVAMLNLFVVAGGNCAHLIDGKDGGVLQTLRTAKMLPRPLRCAYTRHGSSQPESMGLASFTLGYVE
ADSRDCILQTYVPSEDCDAIYLRTPCEARTNNWCTWESARETRKRVADPGVWEMVSDGSAVGIRFDRPVGKKYQV
KAMSGLRNRYGKREAEPDPFEGWQVWMESSPGCRHEESESHRLIKDGEQAGHLLVTEVGPKARVGLNSVAFAFGD
MIKLVIVGSKVRLKERSEGRAGETLMMSAGGRRRKPASLLRGRVAS*
Coding >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCAC
AGCGCTTTTGCTCGCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCC
ACCGTTCTCGTCTATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCAT
GTCTGGACGGTCGCCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTG
CATGCCAGCTATATGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGC
ATTACAAAGAACTTCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCT
CTGACCCAAAGAAATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTG
TACTGGGGTTGCAGTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAG
TCCACATTCGCCAACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTG
GCCGCCGATTCGCTCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCC
TTAGAGCTGCCCAAAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTC
TACGAGTTCCAATTCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTC
TACTTCCTCAAAACTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAA
ATCATGTTCTCCATCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCA
GCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCC
TTGGAGGATGTTGTGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTG
CAGAACGTCGTTCTTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCC
ATTGCCATTGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATA
GAGCTCGGCGAGGCACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGG
GGCCCGGTCTTGCAAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTC
ATCGCACAGTGGCACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGA
GGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTG
CGCATACAGGATCACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGC
GTCTTCGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCG
GCAGCTTACGATTTCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGC
CTGTTGACCAACTTCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTG
TCCGTCAAGTCATTGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTG
TCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGC
GATCAACCCCAGACTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATG
TCGAGGCTTAAGCGAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCG
TCGATCCAGGCCAACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCG
AGGGCGCTCGTCATCCAACAGGACGCCAGAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTGGCAATATCG
AGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATCGAAAAACTG
GATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGCAACTGTGCC
CATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGG
TGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGCTACGTGGAA
GCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTGCGGACGCCG
TGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGT
GTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAATATCAGGTC
AAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGCTGGCAGGTG
TGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGCGAGCAGGCT
GGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCGTTTGGCGAC
ATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGCGAGACACTG
ATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Transcript >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCAC
AGCGCTTTTGCTCGCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCC
ACCGTTCTCGTCTATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCAT
GTCTGGACGGTCGCCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTG
CATGCCAGCTATATGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGC
ATTACAAAGAACTTCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCT
CTGACCCAAAGAAATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTG
TACTGGGGTTGCAGTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAG
TCCACATTCGCCAACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTG
GCCGCCGATTCGCTCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCC
TTAGAGCTGCCCAAAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTC
TACGAGTTCCAATTCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTC
TACTTCCTCAAAACTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAA
ATCATGTTCTCCATCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCA
GCATACCCCCTAGTAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCC
TTGGAGGATGTTGTGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTG
CAGAACGTCGTTCTTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCC
ATTGCCATTGTCTTCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATA
GAGCTCGGCGAGGCACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGG
GGCCCGGTCTTGCAAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTC
ATCGCACAGTGGCACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGA
GGCCAGGGTCCAGGCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTG
CGCATACAGGATCACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGC
GTCTTCGATCCGATCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCG
GCAGCTTACGATTTCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGC
CTGTTGACCAACTTCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTG
TCCGTCAAGTCATTGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTG
TCCGTCGGGCTCGATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGC
GATCAACCCCAGACTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATG
TCGAGGCTTAAGCGAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCG
TCGATCCAGGCCAACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCG
AGGGCGCTCGTCATCCAACAGGACGCCAGAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTGGCAATATCG
AGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATCGAAAAACTG
GATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGCAACTGTGCC
CATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGGCCTTTGAGG
TGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGCTACGTGGAA
GCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTGCGGACGCCG
TGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCGGACCCCGGT
GTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAATATCAGGTC
AAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGCTGGCAGGTG
TGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGCGAGCAGGCT
GGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCGTTTGGCGAC
ATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGCGAGACACTG
ATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA
Gene >Ophcf2|04750
ATGATCTGGTATCTCTTATACCCGTTGCGAGGGTGAGAAACACCCCCATCTTTTCCACCTCAGGCTTGAGCTGAC
TTCCTTCTCCCATCTCTAGGACCACGGAGGCGCCTGTGCTTCCCTCCTCACATCCTCTTCACAGCGCTTTTGCTC
GCTATGGACGCTACGCTGCTCGCCACGTCGTCGCGACTCTTCTCGTCTCTGCCGCCGTGGCCACCGTTCTCGTCT
ATCCCATTCCTTTCCTCTTTACCAGCGACTTCGTCAACGGCGCGTCTAATTTACCTCGCCATGTCTGGACGGTCG
CCCAGCCCCTTGCGTATGACGCCGCCAAGGAGCCAGACATCATCATGCGCTCCATTTGGGTGCATGCCAGCTATA
TGAAGGCCTTGAATACTGAGCTGCTAGTCTCAGCTCTTCAACTTCAAGACGACCTCCTTGGCATTACAAAGAACT
TCAGCCCTGCGAGTGCCCGACATGAGCCTCCTTGGAACGACCTACCCGACCCAGACCTGTCTCTGACCCAAAGAA
ATGCGATCCATGTTGCCAACGGTCTAACTTCGCAGTCTTGGTTCTTTCATTCGCCGTTGCTGTACTGGGGTTGCA
GTCGAGAACGCATTCTGGCCGACGACGATATCCTCTCGACCGTCAACAACAAAAAGAACCAGTCCACATTCGCCA
ACATCACTCTACGTCACTCCATCGTCTTTAGCGGCAAACGATTTCAGGAGCGCCGCTTGCTGGCCGCCGATTCGC
TCGTCATCACCCTATTGCATCTTGACGACTCTCCCGTCGGTCGACGATGGGAGAGACAGGCCTTAGAGCTGCCCA
AAAAGGCAGGGGATAAGTGGAATATATACCCGCCAGACGGACGAGCCGCATCCAGTCAGCTCTACGAGTTCCAAT
TCCGACCCATCTCCATGCAGGACATAGCCAGCCTCGCCTTGGCCTACGGTCTTACCTTGGTCTACTTCCTCAAAA
CTCTATCCACTCTGAGGGCGGTCAAGTCTAGAGCCGGTCTCATGGTCACAGTGCTGGCGCAAATCATGTTCTCCA
TCATGTCCAGCTTCACGGTCTGCGCCATCTTCAACGTCGACCTCTCCCGTATCCCGCGGGCAGCATACCCCCTAG
TAGTCTTGGCCATGAGCCTGGAGCATATCTTTAGGCTCATCAACGCCGTTCTTCTGACGCCCTTGGAGGATGTTG
TGAGCAACAGGATCGGCAAAGCTTTCGCCGAGACGGCTCCGACTGCCATGTTCAGCACCCTGCAGAACGTCGTTC
TTCTTTCGGGCCTCTCCCACCTAGTGTCTGCAGGGGTGTCGGGGTTCTGCGCATTCGCCGCCATTGCCATTGTCT
TCGACTTCTTCTATCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGACGTTCGTCGGATAGAGCTCGGCGAGG
CACTAGCCAAAGCCTCGATGCGACACAACTGTGACTTGCGTGTCGGCCGCCGCTCGTGGTGGGGCCCGGTCTTGC
AAGGGAGGATCGCCCTGTCGACCCGCATTGCGGGCACAATCATCATGTTCGGCTTCGTTCTCATCGCACAGTGGC
ACTTTTTTGGCGACGAGGGCTTGTTCCGTAAACTCGTGCGGTTCTACGGGGACTCTGACCGAGGCCAGGGTCCAG
GCCCTTCCATGTCGTCCTTGCTCGACAGTCTCCACCAAGCGAGGAGCCCTACATCTTGGCTGCGCATACAGGATC
ACGAGACGGCCCGTGAGGTAATCAGTATCATCAAGCCGTCGTCATACAGCTACGTGGCTCGCGTCTTCGATCCGA
TCGTCTTCGTCTTGAAGAACTCGGATCGTGTGCCACCGAGAAAAGAACCTCCCCTGCTGCCGGCAGCTTACGATT
TCATCCGACACGAATTGTTCCGCTTTCTCGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGCCTGTTGACCAACT
TCCTCCTATGGGAGGACGAGGACATCAATGGCAAGCACGAGTCAGACGAGCTTCCGCGGCTGTCCGTCAAGTCAT
TGGCTAGAGGACATCTGATGGACGTCGTGTTACTGACAACGTCGGCGGATGGCCATGTCGTGTCCGTCGGGCTCG
ATAACACGATCCGAGCGTGGTCGGTAAAGGGCATCGGAACGAGCTATGTGATCGCAAGAGGCGATCAACCCCAGA
CTTCCGTGTTCCCCGTGGTGGCAATGGCTATTGACGACGATTCAAGATGGCTCGTCGTCATGTCGAGGCTTAAGC
GAGACGTTTCCTCTAGTGTCAGCTTCAGCTTCTGGGACCTGCAGAGCAGAAGATGGGGCTCGTCGATCCAGGCCA
ACAACTGTCGACATAGACCGGTGGCTCTCCTACTCGACCCTAGCACGCCCAGTGATCAGCCGAGGGCGCTCGTCA
TCCAACAGGACGGTTCGTTGATTGAGATATTGCCAGGCGGCGAGCAGGCGAAGCCACGACCTACTCCCTTATTTC
CTCGACACCTGACATGTGCTCGCTTGCTAGCCAGAGGTAAACCACCCCCAATTAAGCTCTCGGTCGTTGGCGTTG
GTCGCAGCAGAGGGCGCTAATAATCATATCATCGCTCTAGACGGCGGAGATTCCCCCCCGCGGCCGATCATCTTG
GCAATATCGAGGCAGGGCGAGGTCCACATGGCCACTCGAGACAATGGCGTCTGGACACGTCGACGGCTCGCGATC
GAAAAACTGGATGAAACGGGCCCTCATTCCATTCAGGTCGTAGCTATGTTGAATCTATTTGTGGTGGCAGGAGGC
AACTGTGCCCATCTCATCGATGGCAAAGATGGAGGCGTGTTGCAAACGCTGCGTACGGCCAAGATGCTGCCACGG
CCTTTGAGGTGTGCATACACGCGCCACGGCTCTTCACAGCCCGAGTCGATGGGTCTCGCGTCCTTCACTCTCGGC
TACGTGGAAGCCGATTCCCGGGATTGCATATTGCAGACTTATGTGCCGTCGGAAGATTGTGATGCCATATACTTG
CGGACGCCGTGCGAGGCTCGAACGAACAACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGGAAGCGCGTAGCG
GACCCCGGTGTTTGGGAAATGGTTTCTGATGGCAGTGCAGTGGGCATACGGTTTGACCGTCCCGTCGGCAAGAAA
TATCAGGTCAAGGCTATGTCGGGTTTGCGGAACCGATACGGCAAAAGGGAAGCGGAGCCAGACCCATTTGAGGGC
TGGCAGGTGTGGATGGAGTCGTCACCGGGCTGTCGACATGAAGAGAGCGAAAGCCATCGTCTGATCAAGGACGGC
GAGCAGGCTGGGCATCTGCTGGTGACGGAGGTAGGGCCGAAAGCCAGAGTCGGGCTGAACTCGGTCGCGTTTGCG
TTTGGCGACATGATCAAGCTTGTGATTGTCGGGTCAAAAGTGCGGCTCAAGGAGAGGTCCGAGGGCCGGGCGGGC
GAGACACTGATGATGAGCGCCGGTGGCAGACGGCGGAAGCCAGCATCGCTCTTGAGGGGGCGAGTCGCGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail