Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04749
Gene name
Locationscaffold_05:1491870..1493135
Strand-
Gene length (bp)1265
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 1.6E-70 35 308

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6421 0.5932 0.0178 0.0056 0.4236 0.1045 0.1823 0.0419 0.1216 0.0168

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2334
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7568
Ophiocordyceps australis map64 (Brazil) OphauB2|3747
Ophiocordyceps camponoti-floridani Ophcf2|04749 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|10
Ophiocordyceps kimflemingae Ophio5|4143
Ophiocordyceps subramaniannii Hirsu2|3187

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04749
MAVSLHSTFNDLITTFNELNPSSVEELDSEPSPLEFMRFVARNTPFVIRRGASSWKAMSKWNSAYLKQTLQNQAV
NVAVTPKGNADSPAFCPALNQAVLAKPHEELQPFDEFLSYLVEQETDPAFPSDSEVRYAQTQNDNLRDEYLPLYP
DAQKDIPFARISLQKEPDAINLWIGNSHSSTATHKDNFENIFVQVKGRKHFVLLSPLCHACMNEKLLPQATYIRT
DRGLILRPDEQSEPVPFATWDPDRPTKECTPSSHLARPLRVTLEPGDMLYLPAMWYHKVTQSCPLESEGFVVAIN
YWYDMEFSGTLYPLCTFLRTLSQG*
Coding >Ophcf2|04749
ATGGCTGTCTCTTTGCATTCGACTTTTAATGACCTCATCACTACGTTCAACGAGCTGAACCCCTCCTCCGTGGAA
GAGCTCGACTCGGAGCCGAGCCCCCTCGAGTTCATGCGCTTCGTCGCCCGCAACACTCCCTTCGTGATCCGTCGC
GGCGCATCCTCCTGGAAGGCAATGTCGAAATGGAATTCAGCCTATCTGAAGCAAACTCTCCAGAACCAGGCGGTC
AACGTGGCCGTCACTCCCAAGGGAAACGCCGACTCGCCAGCATTTTGCCCTGCTCTCAATCAGGCAGTTCTCGCA
AAACCTCACGAAGAGTTGCAGCCCTTCGATGAGTTTCTCTCTTACCTGGTTGAGCAAGAGACTGACCCAGCCTTT
CCTTCCGACTCGGAGGTGAGATATGCGCAAACCCAAAACGACAATCTCCGTGACGAATATCTACCTCTCTACCCG
GATGCTCAGAAAGATATCCCCTTTGCCCGCATATCTTTGCAGAAGGAGCCGGATGCGATCAATCTCTGGATAGGC
AATTCCCATTCTTCCACTGCCACTCACAAGGATAACTTCGAAAATATCTTTGTTCAAGTAAAGGGTCGGAAGCAC
TTCGTTCTCCTATCACCACTGTGTCACGCGTGCATGAACGAGAAGCTCCTTCCCCAAGCTACATATATTCGAACT
GATCGAGGCTTGATCCTGCGCCCCGACGAGCAGAGCGAGCCAGTTCCTTTTGCGACCTGGGATCCGGACCGTCCT
ACAAAAGAGTGTACCCCTTCCTCGCATCTCGCACGACCGCTGCGCGTTACTTTGGAGCCAGGCGATATGCTCTAC
CTGCCCGCCATGTGGTATCACAAGGTCACGCAGTCTTGCCCACTGGAATCCGAAGGCTTCGTCGTCGCCATCAAC
TACTGGTATGACATGGAGTTTAGCGGAACGCTTTATCCTCTTTGCACGTTTCTTCGTACACTCAGCCAAGGCTAG
Transcript >Ophcf2|04749
ATGGCTGTCTCTTTGCATTCGACTTTTAATGACCTCATCACTACGTTCAACGAGCTGAACCCCTCCTCCGTGGAA
GAGCTCGACTCGGAGCCGAGCCCCCTCGAGTTCATGCGCTTCGTCGCCCGCAACACTCCCTTCGTGATCCGTCGC
GGCGCATCCTCCTGGAAGGCAATGTCGAAATGGAATTCAGCCTATCTGAAGCAAACTCTCCAGAACCAGGCGGTC
AACGTGGCCGTCACTCCCAAGGGAAACGCCGACTCGCCAGCATTTTGCCCTGCTCTCAATCAGGCAGTTCTCGCA
AAACCTCACGAAGAGTTGCAGCCCTTCGATGAGTTTCTCTCTTACCTGGTTGAGCAAGAGACTGACCCAGCCTTT
CCTTCCGACTCGGAGGTGAGATATGCGCAAACCCAAAACGACAATCTCCGTGACGAATATCTACCTCTCTACCCG
GATGCTCAGAAAGATATCCCCTTTGCCCGCATATCTTTGCAGAAGGAGCCGGATGCGATCAATCTCTGGATAGGC
AATTCCCATTCTTCCACTGCCACTCACAAGGATAACTTCGAAAATATCTTTGTTCAAGTAAAGGGTCGGAAGCAC
TTCGTTCTCCTATCACCACTGTGTCACGCGTGCATGAACGAGAAGCTCCTTCCCCAAGCTACATATATTCGAACT
GATCGAGGCTTGATCCTGCGCCCCGACGAGCAGAGCGAGCCAGTTCCTTTTGCGACCTGGGATCCGGACCGTCCT
ACAAAAGAGTGTACCCCTTCCTCGCATCTCGCACGACCGCTGCGCGTTACTTTGGAGCCAGGCGATATGCTCTAC
CTGCCCGCCATGTGGTATCACAAGGTCACGCAGTCTTGCCCACTGGAATCCGAAGGCTTCGTCGTCGCCATCAAC
TACTGGTATGACATGGAGTTTAGCGGAACGCTTTATCCTCTTTGCACGTTTCTTCGTACACTCAGCCAAGGCTAG
Gene >Ophcf2|04749
ATGGCTGTCTCTTTGCATTCGACTTTTAATGACCTCATCACTACGTTCAACGAGCTGAACCCCTCCTCCGTGGAA
GAGCTCGACTCGGAGCCGAGCCCCCTCGAGTTCATGCGCTTCGTCGCCCGCAACACTCCCTTCGTGATCCGTCGC
GGCGCATCCTCCTGGAAGGCAATGTCGAAATGGAATTCAGCCTATCTGAAGCAAACTCTCCAGAACCAGGCGGTC
AACGTGGCCGTCACTCCCAAGGGGTGAGTAACTTGGATAGGCCCAAGGCACTTCTTCACTCGTCCGCTCTGGTCT
CACCAGTTTAGAAACGCCGACTCGCCAGCATTTTGCCCTGCTCTCAATCAGGCAGTTCTCGCAAAACCTCACGAA
GAGTTGCAGCCCTTCGATGAGTTTCTCTCTTACCTGGTTGAGCAAGAGACTGACCCAGCCTTTCCTTCCGACTCG
GAGGTGAGATATGCGCAAACCCGTCAGCCGCCGTCCTAGTCCCGTGCGTTGCGCCGGATCTCGTAGCTTTTGCAT
GCCGGCCCGTTGCGGAATTGACTCTTGGCCTTAGAAAACGACAATCTCCGTGACGAATATCTACCTCTCTACCCG
GATGCTCAGAAAGATATCCCCTTTGCCCGCATATCTTTGCAGAAGGAGCCGGATGCGATCAATCTCTGGATAGGC
AATTCCCATTCTTCCACTGCCACTCACAAGGATAACTTCGAAAATATCTTTGTTCAAGTAAAGGGTCGGAAGCAC
TTCGTTCTCCTATCACCACTGTGTCACGCGTGCATGAACGAGAAGCTCCTTCCCCAAGCTACATATATTCGAACT
GATCGAGGCTTGATCCTGCGCCCCGACGAGCAGAGCGAGCCAGTTCCTTTTGCGACCTGGGATCCGGACCGTCCT
ACAAAAGAGTGTACCCCTTCCTCGCATCTCGCACGACCGCTGCGCGTTACTTTGGAGCCAGGCGATATGCTCTAC
CTGCCCGCCATGTGGTGAGTGCCGAATCCTGCTTAAGGCGTCATGCCGCTCGGACCTCTTTCGGGCACGACCGCT
AAACATGTGATCAATCTTGAGGTATCACAAGGTCACGCAGTCTTGCCCACTGGAATCCGAAGGCTTCGTCGTCGC
CATCAACTACTGGTCAGTTCCGGCAGAACGCGATGATACAGTTCTCTGCCTAGATTAACCGCTTTCACAGGTATG
ACATGGAGTTTAGCGGAACGCTTTATCCTCTTTGCACGTTTCTTCGTACACTCAGCCAAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail