Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04746
Gene name
Locationscaffold_05:1464751..1466176
Strand-
Gene length (bp)1425
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05890 Ebp2 Eukaryotic rRNA processing protein EBP2 6.8E-84 164 419

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1532 0.9149 0.0257 0.0046 0.0383 0.0159 0.0549 0.0034 0.0132 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1681
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7574
Ophiocordyceps australis map64 (Brazil) OphauB2|3741
Ophiocordyceps camponoti-floridani Ophcf2|04746 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7
Ophiocordyceps kimflemingae Ophio5|4146
Ophiocordyceps subramaniannii Hirsu2|1441

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04746
MVTKSKLRLAIAAEKSIDFAKLKQDRKRKAALKRKRTKFEHVSEPTHDDEANASNDAAQVSARFARESPVSVEKE
GRERAEVDVMDEAIEPECSMLHNIDDSETSDSSIDHEEITPREGLSKPGSDRGVKSDDDSDEEDIPMSDVDDLED
EYTEDLIPHTRLTINNTSALKTVLGRILMPIDNSQPFASHQCIVADTETADSVPDVSDDFQRELALYSQSLEAAR
LGRFKLLSERVPFSRPLDYFAEMLKEDAHMEKVKAKLVEEASAKKAAAEARKLRDLKKFGKQVQVAKLQERQKAK
RETLEKIKTLKRKRQESGSGNNTKEAEMFDIAVDNEMTNHSQRASKGTTADGAARKPNAKRQKKNDKYGFGGKKR
NSKSGDAVSSADLSAFDAKRMKAAGPRGRAKAAGKATRPGKARRKVMASRQSAR*
Coding >Ophcf2|04746
ATGGTGACCAAGAGCAAGCTGCGACTCGCGATAGCCGCAGAAAAAAGTATTGACTTTGCAAAGCTGAAGCAGGAC
AGAAAACGAAAGGCGGCCCTAAAACGCAAGAGAACAAAATTCGAGCATGTCAGCGAACCAACACACGACGATGAA
GCGAACGCATCGAATGATGCGGCTCAGGTCAGCGCACGATTCGCGCGCGAATCACCAGTGAGCGTAGAGAAGGAG
GGGCGAGAGCGTGCGGAGGTAGATGTGATGGACGAAGCCATCGAGCCCGAATGTTCAATGCTACATAACATCGAT
GACAGCGAAACATCTGACTCGTCTATTGATCACGAGGAAATAACGCCCCGCGAGGGACTATCAAAGCCCGGCAGT
GACAGAGGAGTTAAGAGTGACGATGACTCCGATGAAGAAGATATTCCCATGTCTGATGTCGATGACCTTGAGGAT
GAATATACCGAAGACCTTATTCCTCACACTCGCCTCACCATCAACAACACTTCGGCATTAAAAACTGTTCTGGGC
CGCATTTTGATGCCCATAGACAACTCTCAGCCTTTCGCTTCCCACCAATGTATTGTCGCCGACACCGAAACAGCC
GACTCTGTTCCGGACGTTTCGGATGATTTCCAGCGCGAGCTTGCTCTGTACTCTCAGTCCCTCGAAGCTGCTCGC
CTTGGCCGGTTTAAGCTGCTATCCGAACGCGTGCCCTTCTCGCGCCCATTGGACTATTTTGCCGAAATGCTCAAG
GAGGATGCACATATGGAGAAGGTCAAGGCGAAGCTGGTCGAGGAGGCATCGGCAAAGAAGGCAGCTGCCGAGGCG
CGGAAGCTCCGTGACCTAAAGAAGTTTGGTAAACAGGTGCAGGTGGCTAAGCTTCAGGAGCGGCAAAAAGCCAAG
CGCGAAACGCTGGAAAAGATCAAGACACTCAAACGAAAGCGACAAGAGTCTGGCAGCGGAAATAACACCAAGGAG
GCCGAAATGTTCGACATCGCCGTCGATAACGAAATGACAAATCACTCCCAGCGGGCGTCCAAGGGCACAACCGCC
GATGGTGCTGCCCGGAAACCAAACGCCAAACGACAGAAGAAGAATGATAAGTACGGGTTCGGCGGAAAGAAGCGC
AACAGCAAATCCGGCGATGCCGTCAGCTCGGCCGACCTCTCGGCCTTTGATGCCAAGAGGATGAAGGCTGCTGGA
CCCAGGGGAAGAGCTAAGGCTGCTGGCAAAGCCACGCGGCCCGGAAAGGCTCGGCGGAAAGTCATGGCTTCGAGG
CAAAGCGCTCGCTGA
Transcript >Ophcf2|04746
ATGGTGACCAAGAGCAAGCTGCGACTCGCGATAGCCGCAGAAAAAAGTATTGACTTTGCAAAGCTGAAGCAGGAC
AGAAAACGAAAGGCGGCCCTAAAACGCAAGAGAACAAAATTCGAGCATGTCAGCGAACCAACACACGACGATGAA
GCGAACGCATCGAATGATGCGGCTCAGGTCAGCGCACGATTCGCGCGCGAATCACCAGTGAGCGTAGAGAAGGAG
GGGCGAGAGCGTGCGGAGGTAGATGTGATGGACGAAGCCATCGAGCCCGAATGTTCAATGCTACATAACATCGAT
GACAGCGAAACATCTGACTCGTCTATTGATCACGAGGAAATAACGCCCCGCGAGGGACTATCAAAGCCCGGCAGT
GACAGAGGAGTTAAGAGTGACGATGACTCCGATGAAGAAGATATTCCCATGTCTGATGTCGATGACCTTGAGGAT
GAATATACCGAAGACCTTATTCCTCACACTCGCCTCACCATCAACAACACTTCGGCATTAAAAACTGTTCTGGGC
CGCATTTTGATGCCCATAGACAACTCTCAGCCTTTCGCTTCCCACCAATGTATTGTCGCCGACACCGAAACAGCC
GACTCTGTTCCGGACGTTTCGGATGATTTCCAGCGCGAGCTTGCTCTGTACTCTCAGTCCCTCGAAGCTGCTCGC
CTTGGCCGGTTTAAGCTGCTATCCGAACGCGTGCCCTTCTCGCGCCCATTGGACTATTTTGCCGAAATGCTCAAG
GAGGATGCACATATGGAGAAGGTCAAGGCGAAGCTGGTCGAGGAGGCATCGGCAAAGAAGGCAGCTGCCGAGGCG
CGGAAGCTCCGTGACCTAAAGAAGTTTGGTAAACAGGTGCAGGTGGCTAAGCTTCAGGAGCGGCAAAAAGCCAAG
CGCGAAACGCTGGAAAAGATCAAGACACTCAAACGAAAGCGACAAGAGTCTGGCAGCGGAAATAACACCAAGGAG
GCCGAAATGTTCGACATCGCCGTCGATAACGAAATGACAAATCACTCCCAGCGGGCGTCCAAGGGCACAACCGCC
GATGGTGCTGCCCGGAAACCAAACGCCAAACGACAGAAGAAGAATGATAAGTACGGGTTCGGCGGAAAGAAGCGC
AACAGCAAATCCGGCGATGCCGTCAGCTCGGCCGACCTCTCGGCCTTTGATGCCAAGAGGATGAAGGCTGCTGGA
CCCAGGGGAAGAGCTAAGGCTGCTGGCAAAGCCACGCGGCCCGGAAAGGCTCGGCGGAAAGTCATGGCTTCGAGG
CAAAGCGCTCGCTGA
Gene >Ophcf2|04746
ATGGTGACCAAGAGCAAGCTGCGACTCGCGATAGCCGCAGAAAAAAGTATTGACTTTGCAAAGCTGAAGCAGGAC
AGAAAACGAAAGGCGGCCCTAAAACGCAAGAGAACAAAATTCGAGCATGTCAGCGAACCAACACACGACGATGAA
GCGAACGCATCGAATGATGCGGCTCAGGTCAGCGCACGATTCGCGCGCGAATCACCAGTGAGCGTAGAGAAGGAG
GGGCGAGAGCGTGCGGAGGTAGATGTGATGGACGAAGCCATCGAGCCCGAATGTGTTCGTTGACCTGCGTGCGAC
CAGCCTACCGGGTTCCCCTAGCTAACCCCCTCTTCCATTAAAATATGCAGTCAATGCTACATAACATCGATGACA
GCGAAACATCTGACTCGTCTATTGATCACGAGGAAATAACGCCCCGCGAGGGACTATCAAAGCCCGGCAGTGACA
GAGGAGTTAAGAGTGACGATGACTCCGATGAAGAAGATATTCCCATGTCTGATGTCGATGACCTTGAGGATGAAT
ATACCGAAGACCTTATTCCTCACACTCGCCTCACCATCAACAACACTTCGGCATTAAAAACTGTTCTGGGCCGCA
TTTTGATGCCCATAGACAACTCTCAGCCTTTCGCTTCCCACCAATGTATTGTCGCCGACACCGAAACAGCCGACT
CTGTTCCGGACGTTTCGGATGATTTCCAGCGCGAGCTTGCTCTGTACTCTCAGTCCCTCGAAGCTGCTCGCCTTG
GCCGGTTTAAGCTGCTATCCGAACGCGTGCCCTTCTCGCGCCCATTGGACTATTTTGCCGAAATGCTCAAGGAGG
ATGCACATATGGAGAAGGTCAAGGCGAAGCTGGTCGAGGAGGCATCGGCAAAGAAGGCAGCTGCCGAGGCGCGGA
AGCTCCGTGACCTAAAGAAGTTTGGTAAACAGGTGCAGGTGGCTAAGCTTCAGGAGCGGCAAAAAGCCAAGCGCG
AAACGCTGGAAAAGATCAAGACACTCAAACGAAGTGAGCAGGCGTTTTCTGATTTTTCTTTCCAACGTTACATGA
AGTCGGCTAACGTGTCAACCAGAGCGACAAGAGTCTGGCAGCGGAAATAACACCAAGGAGGCCGAAATGTTCGAC
ATCGCCGTCGATAACGAAATGACAAATCACTCCCAGCGGGCGTCCAAGGGCACAACCGCCGATGGTGCTGCCCGG
AAACCAAACGCCAAACGACAGAAGAAGAATGATAAGTACGGGTTCGGCGGAAAGAAGCGCAACAGCAAATCCGGC
GATGCCGTCAGCTCGGCCGACCTCTCGGCCTTTGATGCCAAGAGGATGAAGGCTGCTGGACCCAGGGGAAGAGCT
AAGGCTGCTGGCAAAGCCACGCGGCCCGGAAAGGCTCGGCGGAAAGTCATGGCTTCGAGGCAAAGCGCTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail