Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04745
Gene name
Locationscaffold_05:1461686..1464335
Strand+
Gene length (bp)2649
Transcript length (bp)2532
Coding sequence length (bp)2532
Protein length (aa) 844

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00350 Dynamin_N Dynamin family 6.4E-43 161 335
PF01031 Dynamin_M Dynamin central region 1.6E-11 346 477

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2106 0.1865 0.2245 0.0848 0.8723 0.193 0.2865 0.1843 0.1994 0.5878

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2664
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7570
Ophiocordyceps australis map64 (Brazil) OphauB2|3745
Ophiocordyceps camponoti-floridani Ophcf2|04745 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6
Ophiocordyceps kimflemingae Ophio5|4145
Ophiocordyceps subramaniannii Hirsu2|4109

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04745
MFGGLAIGAFAWVQYQATQASNYALEMFNSAKDTVTSTTTTLLRGAQQVTEQARQGWDNTTEQVELPFWLRKILR
LDDEGAGGSGGPGNDGGPKQSRAGAAGVVCASAAALGTDKSTDDEDLRDLEIARDDQMMVLTKKMIEIRSILQQV
GQSTSLTLPSIVVIGSQSSGKSSVLEAIVGHEFLPKGNNMVTRRPIELTLVNTPGSKDDYGEFPDLGLRRVADFS
SIQRTLTELNLAVSSTECASDDPIHLTIYSPNVPDLSLIDLPGYIQVVGQDQPLQLKQKISELCDKYIQPPNVIL
AISAADVDLANSTALRASRRVDPRGERTIGVVTKMDLVDPAKGATILNGNQYPLRLGYVGVVSKAPQLPGLFNIG
TTNPLLAVNKHENSFFSAHPLEFGPDSGLSVGTATLRKKLMQVLEQTMSSSLQSTSDAIKQELEEATYEFKVQYN
DRPLSAESYLAESLDSFKHTFKQFTEQFGRSEMRELLKSELDQKVLDLLAARYWNKPIPDLAAKQPEPDQIVDLP
KTGSSSLYWRRQLDASVSALTKLGVGRLATTVVASSLQGHVDKLLNGSNFATHPFAKEAIQEAASSILKERFYGT
SDQVENCIKPFKFDIDVDEREWAQGRQHVGKVLKKELEDCEAALANLEVSVGSRKKLNEVMNFVDKARKGDIIIE
GDGRSGAGGFSAALLTKGREAVFLRDRAEIVKMRLLAVKSKQCASVDNKYSCPEVFLDAAASKLASTAVLFLNVE
LLSEFYYNFPRELDLRLGRHLSTEEVERFANEDIKIRRHLDLIRRKELLELVLQKMEGLRQLEGRERERDKTGWR
RESDNQRDRWTLFRGSRS*
Coding >Ophcf2|04745
ATGTTTGGCGGCTTAGCTATCGGCGCTTTTGCTTGGGTTCAGTATCAAGCCACTCAGGCGAGTAACTACGCTTTG
GAGATGTTCAACTCTGCCAAAGACACGGTGACGAGTACGACAACGACATTACTGAGGGGAGCTCAGCAAGTAACA
GAGCAGGCACGCCAAGGCTGGGACAATACAACGGAGCAAGTCGAACTGCCTTTTTGGCTGAGAAAAATTTTGCGC
CTCGACGACGAAGGCGCCGGGGGCTCGGGCGGGCCAGGAAACGACGGCGGCCCCAAGCAGAGCAGAGCCGGAGCA
GCGGGTGTAGTTTGCGCCTCAGCGGCTGCACTCGGGACCGACAAATCGACCGACGACGAAGATTTGCGTGACTTG
GAAATAGCTAGAGATGATCAGATGATGGTGTTGACGAAGAAGATGATTGAGATCCGGAGCATACTGCAGCAAGTC
GGCCAGTCGACCTCCCTGACGCTGCCATCCATTGTCGTCATTGGATCGCAGTCTTCTGGCAAGAGCTCCGTCTTG
GAGGCCATCGTCGGGCACGAATTCCTGCCAAAGGGCAACAATATGGTTACGCGTCGACCTATTGAATTGACACTT
GTCAATACCCCTGGGTCCAAGGATGATTACGGGGAATTTCCAGACCTCGGACTGAGGCGCGTTGCAGATTTCTCC
TCCATCCAACGCACGCTCACCGAACTCAATCTCGCCGTTTCGAGCACCGAGTGCGCATCTGACGACCCGATACAC
CTGACAATCTACTCACCCAACGTTCCCGACCTTTCCCTTATTGATCTGCCAGGATATATCCAAGTGGTCGGCCAA
GATCAACCACTTCAACTCAAGCAAAAGATCTCTGAGCTCTGCGATAAGTATATTCAGCCGCCCAATGTCATCTTG
GCCATCTCAGCGGCCGACGTGGATCTTGCCAACTCGACGGCCCTCAGAGCCTCGAGAAGGGTGGATCCGCGCGGT
GAGCGGACCATTGGCGTCGTTACCAAGATGGACCTCGTCGACCCAGCTAAAGGCGCGACTATCCTCAACGGCAAT
CAGTATCCGCTGCGACTCGGTTACGTCGGCGTTGTTTCCAAAGCGCCGCAGCTCCCAGGCCTGTTCAATATCGGG
ACAACTAACCCTCTCTTGGCCGTCAACAAGCACGAGAACTCGTTCTTCTCGGCGCATCCCTTGGAATTTGGCCCA
GATTCGGGACTCAGCGTCGGAACTGCCACGCTTCGGAAGAAGTTGATGCAGGTGCTGGAGCAGACCATGTCATCC
AGCTTGCAGAGCACGAGTGATGCCATTAAACAGGAGCTGGAAGAGGCCACATACGAGTTCAAAGTGCAGTACAAT
GACCGTCCCTTATCTGCCGAGTCTTATCTGGCCGAGAGCCTCGACTCTTTCAAGCACACGTTCAAGCAATTCACT
GAGCAGTTCGGTCGCTCTGAGATGAGAGAGCTCCTGAAGAGCGAGTTGGACCAGAAGGTGCTGGACCTCTTGGCT
GCCAGGTACTGGAACAAGCCAATCCCTGACCTCGCTGCCAAACAACCGGAACCAGACCAGATTGTTGACCTCCCC
AAGACGGGTTCGTCGTCTCTCTACTGGCGCCGGCAGCTGGATGCGTCTGTCTCCGCGCTCACGAAGCTGGGGGTC
GGACGCCTGGCTACGACGGTGGTGGCGTCTTCTCTCCAAGGTCATGTCGATAAGCTACTCAATGGCTCCAACTTT
GCGACGCATCCTTTTGCCAAGGAGGCCATTCAGGAAGCTGCGTCGTCTATTCTCAAGGAGAGATTTTACGGCACC
AGTGACCAGGTCGAGAACTGCATAAAGCCTTTCAAGTTTGACATTGACGTGGACGAACGCGAATGGGCGCAGGGC
CGGCAGCATGTTGGCAAGGTCCTCAAGAAGGAGCTTGAAGATTGTGAGGCTGCCTTGGCCAACCTCGAGGTGTCG
GTAGGCAGCCGTAAGAAGTTGAATGAGGTTATGAACTTCGTCGACAAGGCCCGCAAAGGCGACATCATCATCGAG
GGCGACGGCCGGAGCGGCGCTGGTGGGTTCAGCGCGGCGCTGCTGACCAAAGGTCGCGAAGCTGTCTTTCTTCGA
GACCGCGCAGAAATTGTAAAGATGCGTTTGCTGGCCGTCAAGTCCAAGCAATGCGCGTCAGTCGACAACAAGTAC
AGCTGCCCAGAGGTCTTCCTCGATGCCGCAGCCTCCAAACTAGCCTCGACAGCCGTCCTCTTCCTCAACGTCGAG
CTGCTATCCGAGTTCTACTACAACTTCCCCCGGGAGCTGGACCTCCGTCTCGGCCGCCACCTTAGCACCGAAGAG
GTGGAGAGGTTCGCAAATGAAGACATCAAGATTCGTCGCCACCTGGATCTTATCCGCCGCAAAGAGCTGCTCGAG
CTCGTCTTGCAGAAGATGGAGGGCCTGCGGCAGCTCGAAGGGAGGGAGCGAGAGAGGGATAAGACTGGATGGAGG
CGTGAGTCGGATAACCAGCGCGACCGATGGACTTTGTTTCGAGGATCGCGCTCTTGA
Transcript >Ophcf2|04745
ATGTTTGGCGGCTTAGCTATCGGCGCTTTTGCTTGGGTTCAGTATCAAGCCACTCAGGCGAGTAACTACGCTTTG
GAGATGTTCAACTCTGCCAAAGACACGGTGACGAGTACGACAACGACATTACTGAGGGGAGCTCAGCAAGTAACA
GAGCAGGCACGCCAAGGCTGGGACAATACAACGGAGCAAGTCGAACTGCCTTTTTGGCTGAGAAAAATTTTGCGC
CTCGACGACGAAGGCGCCGGGGGCTCGGGCGGGCCAGGAAACGACGGCGGCCCCAAGCAGAGCAGAGCCGGAGCA
GCGGGTGTAGTTTGCGCCTCAGCGGCTGCACTCGGGACCGACAAATCGACCGACGACGAAGATTTGCGTGACTTG
GAAATAGCTAGAGATGATCAGATGATGGTGTTGACGAAGAAGATGATTGAGATCCGGAGCATACTGCAGCAAGTC
GGCCAGTCGACCTCCCTGACGCTGCCATCCATTGTCGTCATTGGATCGCAGTCTTCTGGCAAGAGCTCCGTCTTG
GAGGCCATCGTCGGGCACGAATTCCTGCCAAAGGGCAACAATATGGTTACGCGTCGACCTATTGAATTGACACTT
GTCAATACCCCTGGGTCCAAGGATGATTACGGGGAATTTCCAGACCTCGGACTGAGGCGCGTTGCAGATTTCTCC
TCCATCCAACGCACGCTCACCGAACTCAATCTCGCCGTTTCGAGCACCGAGTGCGCATCTGACGACCCGATACAC
CTGACAATCTACTCACCCAACGTTCCCGACCTTTCCCTTATTGATCTGCCAGGATATATCCAAGTGGTCGGCCAA
GATCAACCACTTCAACTCAAGCAAAAGATCTCTGAGCTCTGCGATAAGTATATTCAGCCGCCCAATGTCATCTTG
GCCATCTCAGCGGCCGACGTGGATCTTGCCAACTCGACGGCCCTCAGAGCCTCGAGAAGGGTGGATCCGCGCGGT
GAGCGGACCATTGGCGTCGTTACCAAGATGGACCTCGTCGACCCAGCTAAAGGCGCGACTATCCTCAACGGCAAT
CAGTATCCGCTGCGACTCGGTTACGTCGGCGTTGTTTCCAAAGCGCCGCAGCTCCCAGGCCTGTTCAATATCGGG
ACAACTAACCCTCTCTTGGCCGTCAACAAGCACGAGAACTCGTTCTTCTCGGCGCATCCCTTGGAATTTGGCCCA
GATTCGGGACTCAGCGTCGGAACTGCCACGCTTCGGAAGAAGTTGATGCAGGTGCTGGAGCAGACCATGTCATCC
AGCTTGCAGAGCACGAGTGATGCCATTAAACAGGAGCTGGAAGAGGCCACATACGAGTTCAAAGTGCAGTACAAT
GACCGTCCCTTATCTGCCGAGTCTTATCTGGCCGAGAGCCTCGACTCTTTCAAGCACACGTTCAAGCAATTCACT
GAGCAGTTCGGTCGCTCTGAGATGAGAGAGCTCCTGAAGAGCGAGTTGGACCAGAAGGTGCTGGACCTCTTGGCT
GCCAGGTACTGGAACAAGCCAATCCCTGACCTCGCTGCCAAACAACCGGAACCAGACCAGATTGTTGACCTCCCC
AAGACGGGTTCGTCGTCTCTCTACTGGCGCCGGCAGCTGGATGCGTCTGTCTCCGCGCTCACGAAGCTGGGGGTC
GGACGCCTGGCTACGACGGTGGTGGCGTCTTCTCTCCAAGGTCATGTCGATAAGCTACTCAATGGCTCCAACTTT
GCGACGCATCCTTTTGCCAAGGAGGCCATTCAGGAAGCTGCGTCGTCTATTCTCAAGGAGAGATTTTACGGCACC
AGTGACCAGGTCGAGAACTGCATAAAGCCTTTCAAGTTTGACATTGACGTGGACGAACGCGAATGGGCGCAGGGC
CGGCAGCATGTTGGCAAGGTCCTCAAGAAGGAGCTTGAAGATTGTGAGGCTGCCTTGGCCAACCTCGAGGTGTCG
GTAGGCAGCCGTAAGAAGTTGAATGAGGTTATGAACTTCGTCGACAAGGCCCGCAAAGGCGACATCATCATCGAG
GGCGACGGCCGGAGCGGCGCTGGTGGGTTCAGCGCGGCGCTGCTGACCAAAGGTCGCGAAGCTGTCTTTCTTCGA
GACCGCGCAGAAATTGTAAAGATGCGTTTGCTGGCCGTCAAGTCCAAGCAATGCGCGTCAGTCGACAACAAGTAC
AGCTGCCCAGAGGTCTTCCTCGATGCCGCAGCCTCCAAACTAGCCTCGACAGCCGTCCTCTTCCTCAACGTCGAG
CTGCTATCCGAGTTCTACTACAACTTCCCCCGGGAGCTGGACCTCCGTCTCGGCCGCCACCTTAGCACCGAAGAG
GTGGAGAGGTTCGCAAATGAAGACATCAAGATTCGTCGCCACCTGGATCTTATCCGCCGCAAAGAGCTGCTCGAG
CTCGTCTTGCAGAAGATGGAGGGCCTGCGGCAGCTCGAAGGGAGGGAGCGAGAGAGGGATAAGACTGGATGGAGG
CGTGAGTCGGATAACCAGCGCGACCGATGGACTTTGTTTCGAGGATCGCGCTCTTGA
Gene >Ophcf2|04745
ATGTTTGGCGGCTTAGCTATCGGCGCTTTTGCTTGGGTTCAGTATCAAGCCACTCGTGAGTACTTCATGGCTCAA
GACCCTAGGTTGCGCTACCGCCTATACTGATACATCTCCACAGAGGCGAGTAACTACGCTTTGGAGATGTTCAAC
TCTGCCAAAGACACGGTGACGAGTACGACAACGACATTACTGAGGGGAGCTCAGCAAGTAACAGAGCAGGCACGC
CAAGGCTGGGACAATACAACGGAGCAAGTCGAACTGCCTTTTTGGCTGAGAAAAATTTTGCGCCTCGACGACGAA
GGCGCCGGGGGCTCGGGCGGGCCAGGAAACGACGGCGGCCCCAAGCAGAGCAGAGCCGGAGCAGCGGGTGTAGTT
TGCGCCTCAGCGGCTGCACTCGGGACCGACAAATCGACCGACGACGAAGATTTGCGTGACTTGGAAATAGCTAGA
GATGATCAGATGATGGTGTTGACGAAGAAGATGATTGAGATCCGGAGCATACTGCAGCAAGTCGGCCAGTCGACC
TCCCTGACGCTGCCATCCATTGTCGTCATTGGATCGCAGTCTTCTGGCAAGAGCTCCGTCTTGGAGGCCATCGTC
GGGCACGAATTCCTGCCAAAGGGCAACAATATGGTTACGCGTCGACCTATTGAATTGACACTTGTCAATACCCCT
GGGTCCAAGGATGATTACGGGGAATTTCCAGACCTCGGACTGAGGCGCGTTGCAGATTTCTCCTCCATCCAACGC
ACGCTCACCGAACTCAATCTCGCCGTTTCGAGCACCGAGTGCGCATCTGACGACCCGATACACCTGACAATCTAC
TCACCCAACGTTCCCGACCTTTCCCTTATTGATCTGCCAGGATATATCCAAGTGGTCGGCCAAGATCAACCACTT
CAACTCAAGCAAAAGATCTCTGAGCTCTGCGATAAGTATATTCAGCCGCCCAATGTCATCTTGGCCATCTCAGCG
GCCGACGTGGATCTTGCCAACTCGACGGCCCTCAGAGCCTCGAGAAGGGTGGATCCGCGCGGTGAGCGGACCATT
GGCGTCGTTACCAAGATGGACCTCGTCGACCCAGCTAAAGGCGCGACTATCCTCAACGGCAATCAGTATCCGCTG
CGACTCGGTTACGTCGGCGTTGTTTCCAAAGCGCCGCAGCTCCCAGGCCTGTTCAATATCGGGACAACTAACCCT
CTCTTGGCCGTCAACAAGCACGAGAACTCGTTCTTCTCGGCGCATCCCTTGGAATTTGGCCCAGATTCGGGACTC
AGCGTCGGAACTGCCACGCTTCGGAAGAAGTTGATGCAGGTGCTGGAGCAGACCATGTCATCCAGCTTGCAGAGC
ACGAGTGATGCCATTAAACAGGAGCTGGAAGAGGCCACATACGAGTTCAAAGTGCAGTACAATGACCGTCCCTTA
TCTGCCGAGTCTTATCTGGCCGAGAGCCTCGACTCTTTCAAGCACACGTTCAAGCAATTCACTGAGCAGTTCGGT
CGCTCTGAGATGAGAGAGCTCCTGAAGAGCGAGTTGGACCAGAAGGTGCTGGACCTCTTGGCTGCCAGGTACTGG
AACAAGCCAATCCCTGACCTCGCTGCCAAACAACCGGAACCAGACCAGATTGTTGACCTCCCCAAGACGGGTTCG
TCGTCTCTCTACTGGCGCCGGCAGCTGGATGCGTCTGTCTCCGCGCTCACGAAGCTGGGGGTCGGACGCCTGGCT
ACGACGGTGGTGGCGTCTTCTCTCCAAGGTCATGTCGATAAGCTACTCAATGGCTCCAACTTTGCGACGCATCCT
TTTGCCAAGGAGGCCATTCAGGAAGCTGCGTCGTCTATTCTCAAGGAGAGATTTTACGGCACCAGTGACCAGGTC
GAGAACTGCATAAAGCCTTTCAAGTTTGACATTGACGTGGACGAACGCGAATGGGCGCAGGGCCGGCAGCATGTT
GGCAAGGTCCTCAAGAAGGAGCTTGAAGATTGTGAGGCTGCCTTGGCCAACCTCGAGGTGTCGGTAGGCAGCCGT
AAGAAGTTGAATGAGGTTATGAACTTCGTCGACAAGGCCCGCAAAGGCGACATCATCATCGAGGGCGACGGCCGG
AGCGGCGCTGGTGGGTTCAGCGCGGCGCTGCTGACCAAAGGTCACTTCTCCGGTTGAGCGCGCTTTGCACGTTTT
CCTACTGACTAGGTGACAGGTCGCGAAGCTGTCTTTCTTCGAGACCGCGCAGAAATTGTAAAGATGCGTTTGCTG
GCCGTCAAGTCCAAGCAATGCGCGTCAGTCGACAACAAGTACAGCTGCCCAGAGGTCTTCCTCGATGCCGCAGCC
TCCAAACTAGCCTCGACAGCCGTCCTCTTCCTCAACGTCGAGCTGCTATCCGAGTTCTACTACAACTTCCCCCGG
GAGCTGGACCTCCGTCTCGGCCGCCACCTTAGCACCGAAGAGGTGGAGAGGTTCGCAAATGAAGACATCAAGATT
CGTCGCCACCTGGATCTTATCCGCCGCAAAGAGCTGCTCGAGCTCGTCTTGCAGAAGATGGAGGGCCTGCGGCAG
CTCGAAGGGAGGGAGCGAGAGAGGGATAAGACTGGATGGAGGCGTGAGTCGGATAACCAGCGCGACCGATGGACT
TTGTTTCGAGGATCGCGCTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail