Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04741
Gene name
Locationscaffold_05:1416077..1417493
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 6.2E-102 1 402

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5251 0.6577 0.135 0.0293 0.3442 0.0541 0.0806 0.1237 0.1498 0.0434

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 24.33 12.36 36.31
Alive In ants, during behavior modification 37.41 20.12 54.70
Dead In ants, recently dead 19.57 9.39 29.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.030758 yes
Alive Dead 0.000238 yes
Dead Fungus 0.349532 no

Orthologs

Orthofinder run ID4
Orthogroup378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7576
Ophiocordyceps australis map64 (Brazil) OphauB2|3739
Ophiocordyceps camponoti-floridani Ophcf2|04740
Ophiocordyceps camponoti-floridani Ophcf2|04741 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1
Ophiocordyceps camponoti-rufipedis Ophun1|2
Ophiocordyceps kimflemingae Ophio5|4150
Ophiocordyceps kimflemingae Ophio5|4151
Ophiocordyceps subramaniannii Hirsu2|1081

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04741
MAAFIAVRAVLGGVDKAVDWGLLVTLYPNIGLAGLRRFWSDARKQQSAYIALFTRVFQEKLVTALESDEIPMVDF
EKPGDYDWQMLIIWTMKLPRQEGFQLPRSRDLLSEQFTLEHVSAFEEDWREKFFHSGSSFFARLDAFASEPAAIP
VGEKPECARPPSDVDDVVVARSWIRSLLSTGSTSHSIQSIRDKFLQLSPEDSHRRSVLFKTAVTQLAQERVIRRC
RKPRAGHQPYRLSEWYESQLTRMAQTSKYDAAAAFKERLDGAFRRLETFEVPYSLDEGAMMAMTNMNAMGRIRLI
PVGMPDIPYGFRPGHYESRKYPKSLYHFTLQVAPTDAYQYNEDIELLRAVTTESPPLGGSRGELPQWADFLRVCS
VKRWSEILGAFNFVFATRGCMTISGVCSALHPLLEEFEARLVVEWGKQTGVLAEVMDGVGITVAEWWWLAVPWLR
RQGGVCRDRATMTIPQRQNLC*
Coding >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA
Transcript >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA
Gene >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail