Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04741
Gene name
Locationscaffold_05:1416077..1417493
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 6.2E-102 1 402

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5251 0.6577 0.135 0.0293 0.3442 0.0541 0.0806 0.1237 0.1498 0.0434

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7576
Ophiocordyceps australis map64 (Brazil) OphauB2|3739
Ophiocordyceps camponoti-floridani Ophcf2|04740
Ophiocordyceps camponoti-floridani Ophcf2|04741 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1
Ophiocordyceps camponoti-rufipedis Ophun1|2
Ophiocordyceps kimflemingae Ophio5|4150
Ophiocordyceps kimflemingae Ophio5|4151
Ophiocordyceps subramaniannii Hirsu2|1081

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04741
MAAFIAVRAVLGGVDKAVDWGLLVTLYPNIGLAGLRRFWSDARKQQSAYIALFTRVFQEKLVTALESDEIPMVDF
EKPGDYDWQMLIIWTMKLPRQEGFQLPRSRDLLSEQFTLEHVSAFEEDWREKFFHSGSSFFARLDAFASEPAAIP
VGEKPECARPPSDVDDVVVARSWIRSLLSTGSTSHSIQSIRDKFLQLSPEDSHRRSVLFKTAVTQLAQERVIRRC
RKPRAGHQPYRLSEWYESQLTRMAQTSKYDAAAAFKERLDGAFRRLETFEVPYSLDEGAMMAMTNMNAMGRIRLI
PVGMPDIPYGFRPGHYESRKYPKSLYHFTLQVAPTDAYQYNEDIELLRAVTTESPPLGGSRGELPQWADFLRVCS
VKRWSEILGAFNFVFATRGCMTISGVCSALHPLLEEFEARLVVEWGKQTGVLAEVMDGVGITVAEWWWLAVPWLR
RQGGVCRDRATMTIPQRQNLC*
Coding >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA
Transcript >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA
Gene >Ophcf2|04741
ATGGCAGCCTTCATAGCTGTTCGTGCCGTACTTGGGGGGGTTGACAAAGCCGTTGATTGGGGTCTCCTTGTGACC
CTCTACCCGAATATTGGGCTCGCTGGCCTCCGGAGATTCTGGTCAGATGCACGCAAGCAGCAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTTACTGCTCTAGAGAGCGACGAGATTCCCATGGTCGATTTT
GAGAAGCCTGGAGACTACGACTGGCAGATGTTGATCATTTGGACCATGAAATTGCCGCGACAGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGATTTACTCAGCGAACAATTTACCCTGGAACACGTCAGCGCCTTCGAGGAAGACTGGAGG
GAAAAGTTTTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGATGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTCGGGGAGAAGCCCGAATGTGCTCGCCCGCCGTCCGACGTGGACGACGTAGTGGTGGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGGATCGACCTCTCACTCTATCCAAAGCATTAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAGTCATCGACGATCCGTCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAGGAGCGTGTGATACGCCGGTGC
CGGAAGCCCCGAGCGGGACATCAACCCTATCGACTGAGCGAATGGTATGAATCGCAATTGACGAGGATGGCGCAG
ACCTCCAAATACGACGCAGCGGCGGCTTTCAAGGAGCGGCTCGACGGCGCATTTCGCAGGCTGGAGACCTTTGAG
GTACCGTATTCGCTGGATGAAGGTGCCATGATGGCCATGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCCGTGGGGATGCCGGATATCCCGTATGGATTCAGACCGGGCCACTACGAGAGCCGAAAGTACCCGAAATCGCTA
TATCACTTTACACTGCAGGTAGCGCCTACCGACGCGTACCAGTACAATGAGGACATTGAGTTGCTTCGCGCCGTC
ACTACTGAGAGCCCGCCACTTGGGGGTTCACGGGGCGAGCTGCCTCAGTGGGCTGACTTTCTCCGAGTGTGCAGT
GTGAAACGCTGGTCCGAGATTCTGGGAGCTTTCAACTTTGTCTTCGCCACTCGAGGATGTATGACGATCTCAGGG
GTCTGCAGCGCTCTCCATCCCCTGTTGGAGGAGTTCGAGGCTCGACTCGTGGTAGAATGGGGAAAGCAGACAGGA
GTCCTGGCCGAGGTAATGGATGGCGTGGGCATTACGGTGGCGGAGTGGTGGTGGCTTGCTGTTCCGTGGCTGCGT
CGACAGGGGGGGGTCTGCAGAGACCGAGCCACCATGACCATTCCACAACGACAAAATCTCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail