Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04739
Gene name
Locationscaffold_05:1373970..1375297
Strand-
Gene length (bp)1327
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09783 Vac_ImportDeg Vacuolar import and degradation protein 7.6E-69 188 358

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Lysosome/Vacuole Nuclear export signal 0.6007 0.5406 0.0978 0.1281 0.1522 0.014 0.1613 0.6688 0.285 0.2042

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4403
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6504
Ophiocordyceps australis map64 (Brazil) OphauB2|8073
Ophiocordyceps camponoti-floridani Ophcf2|04739 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7447
Ophiocordyceps kimflemingae Ophio5|6178
Ophiocordyceps subramaniannii Hirsu2|9115

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04739
MPTPSSNQPPDPFSPIPFPFPTCPDDVQYTPRLPPHQIDLVASTQPHGIEVQSDTLLDGSSPPAFESRPSRPGEP
ELVALNHPSSTVTFPRAATLTPDTHFTDTPVTSPAPNGPDSNVAKGREAGLDGLVNHASSAALRRCPGRASLIRD
MESQDSFSLDGWDDLLHPTPMGMDFSSKRTIPVSPSSYLRPGSRFHGTQQSERQVYDVQVEIKHVDMRESFLCGY
LRIQGLTEDHPTLTTYFEGEIIGSKYGFITEHDDWGASLKTDMNHWGKFNAFRPFQKLVRKGTCIIGDIAQRDNI
FMRWKEHFLVPDHRVRTITGASFEGFYYICFNQLEGDVSGIYFHSKSEKFQQLELKHVPNRGCFSATEFR*
Coding >Ophcf2|04739
ATGCCGACCCCGTCATCCAATCAGCCGCCTGATCCATTCTCACCCATTCCGTTTCCCTTTCCGACGTGCCCTGAC
GACGTGCAATATACGCCACGACTGCCTCCTCATCAGATCGACCTGGTCGCATCCACGCAACCTCATGGCATAGAG
GTCCAGTCTGACACGCTGCTGGATGGTTCGTCGCCGCCGGCCTTTGAATCTCGGCCCTCTCGGCCAGGTGAACCT
GAACTCGTTGCCCTGAACCATCCGTCGTCCACCGTGACGTTCCCTAGGGCCGCGACATTGACGCCCGATACCCAT
TTTACTGACACACCAGTCACTTCTCCGGCGCCAAACGGGCCGGATAGCAATGTGGCCAAAGGTCGCGAGGCTGGC
CTGGACGGTCTTGTCAATCACGCCTCTTCGGCCGCGCTACGACGCTGCCCCGGCAGGGCGTCGCTCATTCGAGAC
ATGGAATCCCAAGACTCGTTTTCACTCGATGGGTGGGATGACTTACTGCACCCCACCCCAATGGGCATGGACTTT
TCCAGCAAGCGGACCATTCCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACACAGCAG
TCAGAGCGTCAGGTGTATGATGTCCAGGTAGAAATCAAGCATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTAC
TTGCGAATACAAGGCCTCACGGAGGACCACCCTACCCTAACGACGTATTTTGAAGGCGAAATCATTGGATCTAAA
TACGGCTTCATCACCGAACATGATGACTGGGGAGCGAGCCTGAAAACGGACATGAATCATTGGGGAAAATTCAAC
GCATTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATCATAGGCGACATTGCTCAAAGGGACAACATC
TTCATGCGATGGAAGGAACACTTTCTCGTGCCCGATCATCGTGTGCGAACCATTACGGGAGCCAGTTTTGAGGGC
TTCTATTACATCTGCTTCAACCAACTTGAAGGCGATGTCAGCGGGATTTATTTTCATTCCAAAAGCGAAAAGTTC
CAGCAGCTCGAGTTGAAGCACGTACCAAATCGTGGCTGTTTCAGCGCTACAGAGTTCCGATAA
Transcript >Ophcf2|04739
ATGCCGACCCCGTCATCCAATCAGCCGCCTGATCCATTCTCACCCATTCCGTTTCCCTTTCCGACGTGCCCTGAC
GACGTGCAATATACGCCACGACTGCCTCCTCATCAGATCGACCTGGTCGCATCCACGCAACCTCATGGCATAGAG
GTCCAGTCTGACACGCTGCTGGATGGTTCGTCGCCGCCGGCCTTTGAATCTCGGCCCTCTCGGCCAGGTGAACCT
GAACTCGTTGCCCTGAACCATCCGTCGTCCACCGTGACGTTCCCTAGGGCCGCGACATTGACGCCCGATACCCAT
TTTACTGACACACCAGTCACTTCTCCGGCGCCAAACGGGCCGGATAGCAATGTGGCCAAAGGTCGCGAGGCTGGC
CTGGACGGTCTTGTCAATCACGCCTCTTCGGCCGCGCTACGACGCTGCCCCGGCAGGGCGTCGCTCATTCGAGAC
ATGGAATCCCAAGACTCGTTTTCACTCGATGGGTGGGATGACTTACTGCACCCCACCCCAATGGGCATGGACTTT
TCCAGCAAGCGGACCATTCCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACACAGCAG
TCAGAGCGTCAGGTGTATGATGTCCAGGTAGAAATCAAGCATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTAC
TTGCGAATACAAGGCCTCACGGAGGACCACCCTACCCTAACGACGTATTTTGAAGGCGAAATCATTGGATCTAAA
TACGGCTTCATCACCGAACATGATGACTGGGGAGCGAGCCTGAAAACGGACATGAATCATTGGGGAAAATTCAAC
GCATTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATCATAGGCGACATTGCTCAAAGGGACAACATC
TTCATGCGATGGAAGGAACACTTTCTCGTGCCCGATCATCGTGTGCGAACCATTACGGGAGCCAGTTTTGAGGGC
TTCTATTACATCTGCTTCAACCAACTTGAAGGCGATGTCAGCGGGATTTATTTTCATTCCAAAAGCGAAAAGTTC
CAGCAGCTCGAGTTGAAGCACGTACCAAATCGTGGCTGTTTCAGCGCTACAGAGTTCCGATAA
Gene >Ophcf2|04739
ATGCCGACCCCGTCATCCAATCAGCCGCCTGATCCATTCTCACCCATTCCGTTTCCCTTTCCGACGTGCCCTGAC
GACGTGCAATATACGCCACGACTGCCTCCTCATCAGATCGACCTGGTCGCATCCACGCAACCTCATGGCATAGAG
GTCCAGTCTGACACGCTGCTGGATGGTTCGTCGCCGCCGGCCTTTGAATCTCGGCCCTCTCGGCCAGGTGAACCT
GAACTCGTTGCCCTGAACCATCCGTCGTCCACCGTGACGTTCCCTAGGGCCGCGACATTGACGCCCGATACCCAT
TTTACTGACACACCAGTCACTTCTCCGGCGCCAAACGGGCCGGATAGCAATGTGGCCAAAGGTCGCGAGGCTGGC
CTGGACGGTCTTGTCAATCACGCCTCTTCGGCCGCGCTACGACGCTGCCCCGGCAGGGCGTCGCTCATTCGAGAC
ATGGAATCCCAAGACTCGTTTTCACTCGATGGGTGGGATGACTTACTGCACCCCACCCCAATGGGCATGGACTTT
TCCAGCAAGCGGGTATAGCTGTGCACCCCTTACGGACCGCTGTCGCGAACGGAGCTCACAAGTCCCTAGACCATT
CCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACACAGCAGTCAGAGCGTCAGGTGTAT
GATGTCCAGGTAGAAATCAAGCATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTACTTGCGAATACAAGGTTAG
CAAAGCTCTTTGCCCATGTTTAACTAACACTCGCCGCCTGTTCTTCCGGCATACATTGACGCAAACGGGATGGCT
GACACCCCTGCTCTTGTTTTGCAGGCCTCACGGAGGACCACCCTACCCTAACGACGTATTTTGAAGGCGAAATCA
TTGGATCTAAATACGGCTTCATCACCGAACATGATGACTGGGGAGCGAGCCTGAAAACGGACATGAATCATTGGG
GAAAATTCAACGCATTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATCATAGGCGACATTGCTCAAA
GGGACAACATCTTCATGCGATGGAAGGAACACTTTCTCGTGCCCGATCATCGTGTGCGAACCATTACGGGAGCCA
GTTTTGAGGGCTTCTATTACATCTGCTTCAACCAACTTGAAGGCGATGTCAGCGGGATTTATTTTCATTCCAAAA
GCGAAAAGTGAGAGCCTTGCGTCCGCGGCTGGTTGGCTCAACTCTGATAACATATCCTAGGTTCCAGCAGCTCGA
GTTGAAGCACGTACCAAATCGTGGCTGTTTCAGCGCTACAGAGTTCCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail