Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04735
Gene name
Locationscaffold_05:1278942..1282563
Strand-
Gene length (bp)3621
Transcript length (bp)3132
Coding sequence length (bp)3132
Protein length (aa) 1044

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 5.3E-29 135 343
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.3E-08 362 628
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.2E-06 831 1002

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 278 300 22
3 315 337 22
4 801 823 22
5 833 850 17
6 871 893 22
7 918 937 19
8 950 972 22
9 987 1009 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04735
MDLLRTIDYRHVRLCFHPLEDRFVLSSGWKDPEWTDIRSVRTGLDSDKKAVRDIIFGSNLIDTGVKSIVQLLIEE
ALHPFYMFQFASLVLWSMDSYYYYAACIFIISVGTITTTLVETRATMKRLREISRFECDVRVLRNGFWKFVSSSD
LVTGDVYELSDPSLTLLPADSLLLSGDCIVNESMLTGESVPVSKIPATDQTLGILKLNASSISAEISRHFLFSGT
KIIRTRRPQEDHDGDAAALALVVRTGFNTTKGALVRSMLFPKPSGFKLYHDSFKYISVMAAVAGLGFIASFINFL
KLGLEWHLIIVRALDLITIVVPPALPATLTIGTNFAIGRLKKKQIFCISPQRVNVGGKLDMMCFDKTGTLTEDGL
DILGIRVISPDKQRFSDLISKPPLVNYRSRARSGYSDAVQAVLHTMATCHSLHSIDEELAGDPLDVKMFMFTKWS
FEEGKHGTIEREDDEQGTLAPSVVRPPDGSRELGILKSFEFLPQLRRASVVVRHFGQKSGDIFVKGAPEAMKEIC
REGSFPSDYDDQLSYYTHKGYRVIGCATKHLQKLSWVKAQKMHRSEVESKLDFAGFIIFENKLKPTTAGVLKELS
DSGIGTVMVTGDNILTAVSVARESGLLDRDAHCFVPRFCQGDGQDPAAQLRWESIDNSSFSLDGSSLLPLAIPAE
VDASLPFEISSIRNYSLAVSGEIFRWIVAYAPPEVVHRMLVLGKVFARMSPDEKHELVVKLQNIDYSCGFCGDGA
NDCGALKAADVGISLSEAEASVAAPFTSRVFDIRCVLEVIREGRAALVTSFSCFKYMSLYSAIQFTSVSFLYAKA
SNLGDFQFLFVDLLLILPIAVIMGWAKPATTLCPKRPTADLVSRKVLTPLLGVMFICICVQGAAYLTVREQPWYL
PPKLRHDVSNVKNSENTALFLVSCFQYIFAGVLLNAGPPYRQSVTQNWPFILTIALALVATTYMVMVPAHWLRRV
MELTPMSWHYRLFLVSLGVSFLTLSWAYEVYAALPLARWLGTVVRNVAGKKKRHKRYKVIRDEIWKSM*
Coding >Ophcf2|04735
ATGGATCTCCTCCGCACTATAGACTATCGCCACGTCCGCCTCTGCTTTCATCCTCTCGAAGATCGATTTGTTCTT
TCGTCTGGCTGGAAGGATCCCGAATGGACAGACATCCGATCTGTGCGTACTGGCCTGGATAGTGACAAAAAGGCC
GTCCGGGACATCATCTTTGGAAGCAATCTCATCGACACTGGGGTGAAGTCCATTGTGCAGTTGCTCATCGAGGAG
GCTCTGCATCCATTCTACATGTTTCAATTTGCCAGCTTGGTTCTTTGGTCAATGGACTCATACTACTACTATGCT
GCCTGCATCTTCATCATATCGGTCGGGACAATCACGACTACACTAGTCGAAACTCGAGCAACCATGAAACGCTTG
CGCGAAATCTCCCGTTTTGAATGCGACGTTCGTGTGCTTCGAAATGGCTTCTGGAAATTTGTCTCTTCGAGCGAC
CTGGTGACAGGGGACGTCTATGAACTGAGCGACCCGAGTCTCACACTGTTACCGGCGGACAGTCTTCTCCTTAGC
GGCGACTGTATCGTGAATGAGAGCATGCTCACAGGAGAATCCGTTCCGGTTTCGAAGATTCCGGCGACAGACCAA
ACGTTAGGTATCCTGAAACTCAATGCATCGTCTATTTCAGCCGAGATTTCGCGACATTTTCTCTTTAGCGGGACT
AAGATCATCCGCACCAGGAGACCACAAGAAGATCACGACGGCGATGCTGCCGCTCTTGCCCTCGTCGTCCGGACA
GGCTTCAATACGACGAAAGGCGCCCTCGTGCGTTCGATGCTCTTTCCCAAACCATCTGGATTCAAGCTCTACCAT
GACTCGTTCAAATACATTAGTGTCATGGCCGCCGTGGCAGGGCTTGGCTTCATCGCGTCCTTTATCAATTTCCTG
AAGCTGGGATTAGAATGGCACCTTATCATTGTGCGAGCTCTGGATCTCATAACGATAGTCGTCCCGCCTGCTCTT
CCAGCTACCCTAACAATCGGAACAAACTTCGCTATTGGTCGTCTGAAAAAGAAACAAATATTTTGCATTAGTCCG
CAGAGGGTGAACGTCGGTGGCAAACTCGACATGATGTGCTTTGACAAAACAGGCACCCTGACTGAGGATGGCCTG
GATATTCTCGGCATCAGAGTTATTTCGCCGGACAAGCAAAGATTCAGCGACCTGATCTCGAAGCCTCCTCTGGTG
AATTATAGGAGCAGGGCACGTTCGGGCTACTCGGACGCGGTCCAAGCCGTGCTTCACACGATGGCTACCTGCCAC
TCGTTGCATTCAATAGATGAGGAGCTGGCTGGGGACCCTCTGGATGTCAAAATGTTTATGTTTACCAAATGGTCC
TTTGAGGAAGGTAAGCACGGGACAATAGAGCGCGAAGATGATGAGCAAGGCACCCTCGCACCGTCGGTCGTGCGC
CCACCGGACGGATCTCGAGAGCTCGGAATACTCAAGTCATTCGAGTTCCTGCCGCAGCTACGGCGGGCAAGTGTC
GTTGTACGGCATTTTGGGCAAAAAAGCGGAGACATATTCGTCAAAGGCGCGCCTGAGGCTATGAAAGAAATATGT
CGCGAAGGGAGTTTCCCTAGTGATTACGACGATCAGCTGTCGTACTACACTCACAAGGGATACCGCGTCATCGGC
TGCGCGACGAAACACTTACAAAAGCTAAGCTGGGTTAAGGCGCAGAAGATGCATAGATCCGAAGTTGAAAGCAAG
CTGGACTTTGCCGGCTTCATCATCTTCGAAAATAAACTGAAACCAACAACGGCAGGCGTGCTCAAGGAGTTGTCG
GATTCCGGCATCGGAACTGTCATGGTGACTGGTGACAATATCTTGACGGCCGTCAGCGTCGCGCGAGAAAGCGGA
CTATTGGATCGAGATGCACACTGCTTTGTTCCACGATTCTGCCAAGGCGATGGTCAAGATCCCGCGGCCCAGCTT
CGTTGGGAGAGCATCGACAACAGCAGTTTTAGCCTCGATGGATCCAGCTTGTTGCCCCTTGCGATACCTGCAGAA
GTTGACGCATCTCTGCCGTTCGAGATTTCCAGTATTCGAAACTACTCGCTCGCCGTTAGCGGGGAAATTTTCCGA
TGGATCGTGGCATATGCGCCTCCAGAAGTCGTCCACAGGATGCTCGTTCTGGGCAAAGTATTTGCCAGAATGTCA
CCAGACGAGAAACACGAGCTGGTTGTGAAACTTCAAAACATCGACTATTCATGCGGGTTTTGCGGCGATGGGGCC
AACGACTGCGGCGCGTTGAAAGCTGCAGACGTCGGCATCTCGCTGTCGGAGGCTGAAGCGTCCGTCGCAGCTCCC
TTTACGTCTCGTGTCTTTGACATCCGGTGCGTCTTGGAGGTTATCAGGGAAGGGAGAGCCGCATTGGTGACGAGC
TTCAGTTGCTTTAAGTACATGAGCCTGTATTCTGCGATCCAGTTTACGTCGGTCAGCTTTCTTTACGCGAAAGCG
TCCAATTTGGGCGACTTTCAGTTCCTCTTCGTCGATCTGCTGCTGATTTTGCCTATCGCCGTCATCATGGGATGG
GCCAAGCCGGCGACGACCCTGTGCCCGAAACGGCCGACTGCGGACCTCGTTTCGCGCAAAGTCCTGACGCCGTTG
CTGGGCGTCATGTTCATCTGTATCTGCGTTCAAGGCGCGGCTTACTTGACGGTCCGAGAACAGCCGTGGTATCTG
CCACCAAAACTCAGGCACGATGTGTCGAATGTCAAGAACTCGGAGAACACAGCCCTGTTTCTGGTGTCCTGCTTT
CAATACATATTTGCAGGGGTGCTCCTCAACGCGGGCCCACCATACAGGCAGTCCGTCACGCAGAACTGGCCCTTC
ATCCTCACCATCGCGCTGGCGCTGGTGGCAACAACTTATATGGTCATGGTGCCAGCGCACTGGCTCAGACGAGTG
ATGGAGCTCACGCCAATGAGCTGGCACTACAGGTTATTTCTTGTGAGCTTGGGGGTCTCGTTCCTCACTCTGTCA
TGGGCCTACGAGGTATACGCAGCCCTTCCACTGGCGAGATGGCTAGGCACTGTCGTACGGAACGTTGCGGGCAAA
AAGAAGCGGCACAAGCGGTACAAGGTGATTCGCGACGAGATTTGGAAAAGTATGTAA
Transcript >Ophcf2|04735
ATGGATCTCCTCCGCACTATAGACTATCGCCACGTCCGCCTCTGCTTTCATCCTCTCGAAGATCGATTTGTTCTT
TCGTCTGGCTGGAAGGATCCCGAATGGACAGACATCCGATCTGTGCGTACTGGCCTGGATAGTGACAAAAAGGCC
GTCCGGGACATCATCTTTGGAAGCAATCTCATCGACACTGGGGTGAAGTCCATTGTGCAGTTGCTCATCGAGGAG
GCTCTGCATCCATTCTACATGTTTCAATTTGCCAGCTTGGTTCTTTGGTCAATGGACTCATACTACTACTATGCT
GCCTGCATCTTCATCATATCGGTCGGGACAATCACGACTACACTAGTCGAAACTCGAGCAACCATGAAACGCTTG
CGCGAAATCTCCCGTTTTGAATGCGACGTTCGTGTGCTTCGAAATGGCTTCTGGAAATTTGTCTCTTCGAGCGAC
CTGGTGACAGGGGACGTCTATGAACTGAGCGACCCGAGTCTCACACTGTTACCGGCGGACAGTCTTCTCCTTAGC
GGCGACTGTATCGTGAATGAGAGCATGCTCACAGGAGAATCCGTTCCGGTTTCGAAGATTCCGGCGACAGACCAA
ACGTTAGGTATCCTGAAACTCAATGCATCGTCTATTTCAGCCGAGATTTCGCGACATTTTCTCTTTAGCGGGACT
AAGATCATCCGCACCAGGAGACCACAAGAAGATCACGACGGCGATGCTGCCGCTCTTGCCCTCGTCGTCCGGACA
GGCTTCAATACGACGAAAGGCGCCCTCGTGCGTTCGATGCTCTTTCCCAAACCATCTGGATTCAAGCTCTACCAT
GACTCGTTCAAATACATTAGTGTCATGGCCGCCGTGGCAGGGCTTGGCTTCATCGCGTCCTTTATCAATTTCCTG
AAGCTGGGATTAGAATGGCACCTTATCATTGTGCGAGCTCTGGATCTCATAACGATAGTCGTCCCGCCTGCTCTT
CCAGCTACCCTAACAATCGGAACAAACTTCGCTATTGGTCGTCTGAAAAAGAAACAAATATTTTGCATTAGTCCG
CAGAGGGTGAACGTCGGTGGCAAACTCGACATGATGTGCTTTGACAAAACAGGCACCCTGACTGAGGATGGCCTG
GATATTCTCGGCATCAGAGTTATTTCGCCGGACAAGCAAAGATTCAGCGACCTGATCTCGAAGCCTCCTCTGGTG
AATTATAGGAGCAGGGCACGTTCGGGCTACTCGGACGCGGTCCAAGCCGTGCTTCACACGATGGCTACCTGCCAC
TCGTTGCATTCAATAGATGAGGAGCTGGCTGGGGACCCTCTGGATGTCAAAATGTTTATGTTTACCAAATGGTCC
TTTGAGGAAGGTAAGCACGGGACAATAGAGCGCGAAGATGATGAGCAAGGCACCCTCGCACCGTCGGTCGTGCGC
CCACCGGACGGATCTCGAGAGCTCGGAATACTCAAGTCATTCGAGTTCCTGCCGCAGCTACGGCGGGCAAGTGTC
GTTGTACGGCATTTTGGGCAAAAAAGCGGAGACATATTCGTCAAAGGCGCGCCTGAGGCTATGAAAGAAATATGT
CGCGAAGGGAGTTTCCCTAGTGATTACGACGATCAGCTGTCGTACTACACTCACAAGGGATACCGCGTCATCGGC
TGCGCGACGAAACACTTACAAAAGCTAAGCTGGGTTAAGGCGCAGAAGATGCATAGATCCGAAGTTGAAAGCAAG
CTGGACTTTGCCGGCTTCATCATCTTCGAAAATAAACTGAAACCAACAACGGCAGGCGTGCTCAAGGAGTTGTCG
GATTCCGGCATCGGAACTGTCATGGTGACTGGTGACAATATCTTGACGGCCGTCAGCGTCGCGCGAGAAAGCGGA
CTATTGGATCGAGATGCACACTGCTTTGTTCCACGATTCTGCCAAGGCGATGGTCAAGATCCCGCGGCCCAGCTT
CGTTGGGAGAGCATCGACAACAGCAGTTTTAGCCTCGATGGATCCAGCTTGTTGCCCCTTGCGATACCTGCAGAA
GTTGACGCATCTCTGCCGTTCGAGATTTCCAGTATTCGAAACTACTCGCTCGCCGTTAGCGGGGAAATTTTCCGA
TGGATCGTGGCATATGCGCCTCCAGAAGTCGTCCACAGGATGCTCGTTCTGGGCAAAGTATTTGCCAGAATGTCA
CCAGACGAGAAACACGAGCTGGTTGTGAAACTTCAAAACATCGACTATTCATGCGGGTTTTGCGGCGATGGGGCC
AACGACTGCGGCGCGTTGAAAGCTGCAGACGTCGGCATCTCGCTGTCGGAGGCTGAAGCGTCCGTCGCAGCTCCC
TTTACGTCTCGTGTCTTTGACATCCGGTGCGTCTTGGAGGTTATCAGGGAAGGGAGAGCCGCATTGGTGACGAGC
TTCAGTTGCTTTAAGTACATGAGCCTGTATTCTGCGATCCAGTTTACGTCGGTCAGCTTTCTTTACGCGAAAGCG
TCCAATTTGGGCGACTTTCAGTTCCTCTTCGTCGATCTGCTGCTGATTTTGCCTATCGCCGTCATCATGGGATGG
GCCAAGCCGGCGACGACCCTGTGCCCGAAACGGCCGACTGCGGACCTCGTTTCGCGCAAAGTCCTGACGCCGTTG
CTGGGCGTCATGTTCATCTGTATCTGCGTTCAAGGCGCGGCTTACTTGACGGTCCGAGAACAGCCGTGGTATCTG
CCACCAAAACTCAGGCACGATGTGTCGAATGTCAAGAACTCGGAGAACACAGCCCTGTTTCTGGTGTCCTGCTTT
CAATACATATTTGCAGGGGTGCTCCTCAACGCGGGCCCACCATACAGGCAGTCCGTCACGCAGAACTGGCCCTTC
ATCCTCACCATCGCGCTGGCGCTGGTGGCAACAACTTATATGGTCATGGTGCCAGCGCACTGGCTCAGACGAGTG
ATGGAGCTCACGCCAATGAGCTGGCACTACAGGTTATTTCTTGTGAGCTTGGGGGTCTCGTTCCTCACTCTGTCA
TGGGCCTACGAGGTATACGCAGCCCTTCCACTGGCGAGATGGCTAGGCACTGTCGTACGGAACGTTGCGGGCAAA
AAGAAGCGGCACAAGCGGTACAAGGTGATTCGCGACGAGATTTGGAAAAGTATGTAA
Gene >Ophcf2|04735
ATGGATCTCCTCCGCACTATAGACTATCGCCACGTCCGCCTCTGCTTTCATCCTCTCGAAGATCGATTTGTTCTT
TCGTCTGGCTGGAAGGATCCCGAATGGACAGACATCCGATCTGTGCGTACTGGCCTGGATAGTGACAAAAAGGCC
GTCCGGGACATCATCTTTGGAAGCAATCTCATCGACACTGGGGTGAAGTCCATTGTGCAGTTGCTCATCGAGGAG
GTTAGCCATCCGCAGCCTACTGCAATCCGCGATTGATTCTGACTAGGAATGATACCATTGCCCGTTTTACAGGCT
CTGCATCCATTCTACATGTTTCAATTTGCCAGCTTGGTTCTTTGGTCAATGGACTCATACTACTACTATGCTGCC
TGCATCTTCATCATATCGGTCGGGACAATCACGACTACACTAGTCGAAACTCGAGCAACCATGAAACGCTTGCGC
GAAATCTCCCGTTTTGAATGCGACGTTCGTGTGCTTCGAAATGGCTTCTGGAAATTTGTCTCTTCGAGCGACCTG
GTGACAGGGGACGTCTATGAACTGAGCGACCCGAGTCTCACACTGTTACCGGCGGACAGTCTTCTCCTTAGCGGC
GACTGTATCGTGAATGAGAGCATGCTCACAGGTTAGTTCCTGGACCTACTCCAATGGAACGATCGGCGTGTTGAT
TGGCACAGGAGAATCCGTTCCGGTTTCGAAGATTCCGGCGACAGACCAAACGTTAGGTATCCTGAAACTCAATGC
ATCGTCTATTTCAGCCGAGATTTCGCGACATTTTCTCTTTAGCGGGACTAAGATCATCCGCACCAGGAGACCACA
AGAAGATCACGACGGCGATGCTGCCGCTCTTGCCCTCGTCGTCCGGACAGGCTTCAATACGACGAAAGGCGCCCT
CGTGCGTTCGATGCTCTTTCCCAAACCATCTGGATTCAAGCTCTACCATGACTCGTTCAAATACATTAGTGTCAT
GGCCGCCGTGGCAGGGCTTGGCTTCATCGCGTCCTTTATCAATTTCCTGAAGCTGGGATTAGAATGGCACCTTAT
CATTGTGCGAGCTCTGGATCTCATAACGATAGTCGTCCCGCCTGCTCTTCCAGCTACCCTAACAATCGGAACAAA
CTTCGCTATTGGTCGTCTGAAAAAGAAACAAATATTTTGCATTAGTCCGCAGAGGGTGAACGTCGGTGGCAAACT
CGACATGATGTGCTTTGACAAAACAGGCACCCTGACTGAGGATGGCCTGGATATTCTCGGCATCAGAGTTATTTC
GCCGGACAAGCAAAGATTCAGCGACCTGATCTCGAAGCCTCCTCTGGTGAATTATAGGAGCAGGGCACGTTCGGG
CTACTCGGACGCGGTCCAAGCCGTGCTTCACACGATGGCTACCTGCCACTCGTTGCATTCAATAGATGAGGAGCT
GGCTGGGGACCCTCTGGATGTCAAAATGTTTATGTTTACCAAATGGTCCTTTGAGGAAGGTAAGCACGGGACAAT
AGAGCGCGAAGATGATGAGCAAGGCACCCTCGCACCGTCGGTCGTGCGCCCACCGGACGTAAGATAATCCTCAGC
GAGTGTTGACTGATGGTTTGCCTAACAATTTGCAAACAGGGATCTCGAGAGCTCGGAATACTCAAGTCATTCGAG
TTCCTGCCGCAGCTACGGCGGGCAAGTGTCGTTGTACGGCATTTTGGGCAAAAAAGCGGAGACATATTCGTCAAA
GGCGCGCCTGAGGCTATGAAAGAAATATGTCGCGAAGGGAGTTGTGAGTATTGCCTGTCTATTGTCGACTCGAGA
CGCCGGCTAAATAAGGCAGTCCCTAGTGATTACGACGATCAGCTGTCGTACTACACTCACAAGGGATACCGCGTC
ATCGGCTGCGCGACGAAACACTTACAAAAGCTAAGCTGGGTTAAGGCGCAGAAGATGCATAGATCCGAAGTTGAA
AGCAAGCTGGACTTTGCCGGCTTCATCATCTTCGAAAATAAACTGAAACCAACAACGGCAGGCGTGCTCAAGGAG
TTGTCGGATTCCGGCATCGGAACTGTCATGGTGACTGGTGACAATATCTTGACGGCCGTCAGCGTCGCGCGAGAA
AGCGGACTATTGGATCGAGATGCACACTGCTTTGTTCCACGATTCTGCCAAGGTGAACAACTTGCGCTGGCTTCT
TGCGCCGAGACTGATTGTTGGAAGGCGATGGTCAAGATCCCGCGGCCCAGCTTCGTTGGGAGAGCATCGACAACA
GCAGTTTTAGCCTCGATGGATCCAGCTTGTTGGTATGTTTCGTGATAGATGATCAGAGGCAAAATGCGAGGCAGA
CGAGCTGATGGCGGAGTAGCCCCTTGCGATACCTGCAGAAGTTGACGCATCTCTGCCGTTCGAGATTTCCAGTAT
TCGAAACTACTCGCTCGCCGTTAGCGGGGAAATTTTCCGATGGATCGTGGCATATGCGCCTCCAGAAGTCGTCCA
CAGGGTGAGCGGTCCGGACGATTGACCCAGTTGCCGTATATTGATACAGCGAGCAGATGCTCGTTCTGGGCAAAG
TATTTGCCAGAATGTCACCAGACGAGAAACACGAGCTGGTTGTGAAACTTCAAAACATCGACTATTCATGCGGGT
TTTGCGGCGATGGGGCCAACGACTGCGGCGCGTTGAAAGCTGCAGACGTCGGCATCTCGCTGTCGGAGGCTGAAG
CGTCCGTCGCAGCTCCCTTTACGTCTCGTGTCTTTGACATCCGGTGCGTCTTGGAGGTTATCAGGTAACCATACC
AATTTACAGTCTCTTGCCTTTGCACGCTTACATGGACGCAGGGAAGGGAGAGCCGCATTGGTGACGAGCTTCAGT
TGCTTTAAGTACATGAGCCTGTATTCTGCGATCCAGTTTACGTCGGTCAGCTTTCTTTACGCGAAAGCGTCCAAT
TTGGGCGACTTTCAGTTCCTCTTCGTCGATCTGCTGCTGATTTTGCCTATCGCCGTCATCATGGGATGGGCCAAG
CCGGCGACGACCCTGTGCCCGAAACGGCCGACTGCGGACCTCGTTTCGCGCAAAGTCCTGACGCCGTTGCTGGGC
GTCATGTTCATCTGTATCTGCGTTCAAGGCGCGGCTTACTTGACGGTCCGAGAACAGCCGTGGTATCTGCCACCA
AAACTCAGGCACGATGTGTCGAATGTCAAGAACTCGGAGAACACAGCCCTGTTTCTGGTGTCCTGCTTTCAATAC
ATATTTGCAGGGGTGCTCCTCAACGCGGGCCCACCATACAGGCAGTCCGTCACGCAGAACTGTGAGTTTCATTCC
TGTGTCGGGGAAAACAGCTAACATAGACAAGGGCCCTTCATCCTCACCATCGCGCTGGCGCTGGTGGCAACAACT
TATATGGTCATGGTGCCAGCGCACTGGCTCAGACGAGTGATGGAGCTCACGCCAATGAGCTGGCACTACAGGTTA
TTTCTTGTGAGCTTGGGGGTCTCGTTCCTCACTCTGTCATGGGCCTACGAGGTATACGCAGCCCTTCCACTGGCG
AGATGGCTAGGCACTGTCGTACGGAACGTTGCGGGCAAAAAGAAGCGGCACAAGCGGTACAAGGTGATTCGCGAC
GAGATTTGGAAAAGTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail