Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04720
Gene name
Locationscaffold_05:835743..836618
Strand+
Gene length (bp)875
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12998 ING Inhibitor of growth proteins N-terminal histone-binding 1.8E-23 26 129

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5466 0.5927 0.1806 0.0919 0.3355 0.0133 0.2096 0.1837 0.166 0.0318

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4122
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6774
Ophiocordyceps australis map64 (Brazil) OphauB2|5562
Ophiocordyceps camponoti-floridani Ophcf2|04720 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7113
Ophiocordyceps kimflemingae Ophio5|237
Ophiocordyceps subramaniannii Hirsu2|8350

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04720
MPRDDLTIDFVKKMPLAEPLDPALILDDWINRVQNLPEEIRFMQDEISVKDRLYHECIRSIEDRDEKIQKWIKLN
GSLEPNPKEDLWRSQIREFYNRADQLSQEKMALAQRLQVIVEKHLRSLDVQIKLLYDRGDPGFTDPDEVPSLLRP
RAANHTAPTDRSINPATATATVPGTTSSPLNPAPPLANLTAARMPSHPQIRNAQAQQGCLQHAASAPTTPAAGLI
LGRQLVAWPRDTQKRAFCCLSGRCRESWQYWPTW*
Coding >Ophcf2|04720
ATGCCCAGAGACGACTTGACCATCGACTTCGTCAAGAAGATGCCCCTGGCCGAGCCCCTCGACCCTGCGCTGATC
CTCGATGACTGGATCAATCGCGTTCAAAACCTTCCCGAGGAAATACGCTTTATGCAGGACGAGATCTCAGTTAAG
GATCGCCTGTACCACGAATGTATTCGGTCAATAGAAGATCGTGATGAGAAAATTCAAAAGTGGATTAAGTTAAAC
GGAAGCTTAGAGCCAAATCCGAAAGAAGATCTATGGCGCAGTCAGATCCGCGAGTTTTACAACCGCGCCGACCAG
TTGTCCCAGGAAAAGATGGCACTGGCACAAAGGCTGCAGGTCATCGTGGAGAAACATTTACGGAGTCTCGATGTT
CAGATCAAACTTCTTTATGACCGAGGGGATCCTGGATTTACGGATCCCGACGAAGTGCCCTCATTGCTGCGTCCT
AGAGCTGCGAATCACACTGCCCCCACGGACCGCTCCATCAATCCTGCAACTGCCACCGCTACGGTCCCCGGCACC
ACTTCTTCGCCTTTGAACCCGGCGCCACCATTGGCGAACCTGACTGCGGCGCGGATGCCATCGCATCCACAGATC
AGGAACGCCCAGGCGCAGCAGGGCTGCCTACAACACGCAGCATCTGCACCAACCACTCCGGCAGCGGGTCTGATA
CTTGGCCGACAACTCGTCGCTTGGCCCCGGGACACCCAAAAGCGGGCCTTCTGCTGTCTCAGCGGGCGATGCCGC
GAGAGCTGGCAGTACTGGCCCACGTGGTAG
Transcript >Ophcf2|04720
ATGCCCAGAGACGACTTGACCATCGACTTCGTCAAGAAGATGCCCCTGGCCGAGCCCCTCGACCCTGCGCTGATC
CTCGATGACTGGATCAATCGCGTTCAAAACCTTCCCGAGGAAATACGCTTTATGCAGGACGAGATCTCAGTTAAG
GATCGCCTGTACCACGAATGTATTCGGTCAATAGAAGATCGTGATGAGAAAATTCAAAAGTGGATTAAGTTAAAC
GGAAGCTTAGAGCCAAATCCGAAAGAAGATCTATGGCGCAGTCAGATCCGCGAGTTTTACAACCGCGCCGACCAG
TTGTCCCAGGAAAAGATGGCACTGGCACAAAGGCTGCAGGTCATCGTGGAGAAACATTTACGGAGTCTCGATGTT
CAGATCAAACTTCTTTATGACCGAGGGGATCCTGGATTTACGGATCCCGACGAAGTGCCCTCATTGCTGCGTCCT
AGAGCTGCGAATCACACTGCCCCCACGGACCGCTCCATCAATCCTGCAACTGCCACCGCTACGGTCCCCGGCACC
ACTTCTTCGCCTTTGAACCCGGCGCCACCATTGGCGAACCTGACTGCGGCGCGGATGCCATCGCATCCACAGATC
AGGAACGCCCAGGCGCAGCAGGGCTGCCTACAACACGCAGCATCTGCACCAACCACTCCGGCAGCGGGTCTGATA
CTTGGCCGACAACTCGTCGCTTGGCCCCGGGACACCCAAAAGCGGGCCTTCTGCTGTCTCAGCGGGCGATGCCGC
GAGAGCTGGCAGTACTGGCCCACGTGGTAG
Gene >Ophcf2|04720
ATGCCCAGAGACGACTTGACCATCGACTTCGTCAAGAAGATGCCCCTGGCCGAGCCCCTCGACCCTGCGCTGATC
CTCGATGACTGGATCAATCGCGTTCAAAACCTTCCCGAGGAAATACGCTTTATGCAGGACGAGATCTCAGTTAAG
GATCGCCTGTACCACGAATGTATTCGGTCAATAGAAGATCGTGATGAGAAAATTCAAAAGTGGATTAAGTTAAAC
GGAAGCTTAGAGCCAAATCCGAAAGAAGATCTATGGCGCAGTCAGATCCGCGAGTTTTACAACCGCGCCGACCAG
TTGTCCCAGGAAAAGATGGCACTGGCACAAAGGCTGCAGGTCATCGTGGAGAAACATTTACGGAGTCTCGATGTT
CAGATCAAACTTCTTTATGACCGAGGGGATCCTGGATTTACGGATCCCGACGAAGTGCCCTCATTGCTGCGTCCT
AGAGCTGCGAATCACACTGCCCCCACGGACCGCTCCATCAATCCTGCAACTGCCACCGCTACGGTCCCCGGCACC
ACTTCTTCGCCTTTGAACCCGGCGCCACCATTGGCGAACCTGACTGCGGCGCGGATGCCATCGCATCCACAGATC
AGGAACGCCCAGGCGCAGCAGGGCTGCCTACAACACGCAGCATCTGCACCAACCACTCCGGCAGCGGGTCTGATA
CTTGGCCGACAACGTGAGGCCTCTATTGGTCCTGCCACAAAGCGAGGGCCCCGATCCACCACCGGTACTGGAAAT
GCATCTGCTGCGTCTGGCAATTTATCAAGACAGTCGTCGCTTGGCCCCGGGACACCCAAAAGCGGGCCTTCTGCT
GTCTCAGCGGGCGATGCCGCGAGAGCTGGCAGTACTGGCCCACGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail