Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04717
Gene name
Locationscaffold_05:568325..569328
Strand-
Gene length (bp)1003
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16455 UBD Ubiquitin-binding domain 9.5E-37 63 174

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5699 0.7071 0.0159 0.1707 0.2595 0.0033 0.103 0.3697 0.1574 0.0399

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4401
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4196
Ophiocordyceps australis map64 (Brazil) OphauB2|8077
Ophiocordyceps camponoti-floridani Ophcf2|04717 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6402
Ophiocordyceps kimflemingae Ophio5|6181
Ophiocordyceps subramaniannii Hirsu2|9110

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04717
MGCCLSSSAGPNSPYPGGGHNASSAHHINPPSVAAPEAPPPGPSTPGRHRRHRDASPLHHHINNPLRRHEWSSND
RHWTRSRLDRERADFFDTRVAGQPHIWQTIHAALQVLDQLPMADDSNDDYHDALATAQSILSAADISIPTGDLAN
GVYDSLGNYYKLPCWVVADPTNLAIDSDAHPKDSSPMDTDQADSDDAARRRAEKGKAVVHLHEHVVLRARLSETG
RDIELAVNKAELVRAVAVGLAFKAALPSNKKIRLAYMGKMLKDSSSLESQGWQSGHVVNAFVFPR*
Coding >Ophcf2|04717
ATGGGCTGCTGCCTCTCCAGCTCAGCTGGCCCCAATTCGCCATATCCCGGCGGCGGCCACAACGCCTCCTCCGCT
CATCACATCAATCCGCCCTCTGTTGCCGCCCCCGAAGCGCCTCCCCCTGGTCCCTCGACTCCGGGCCGTCATCGT
CGCCACCGTGATGCAAGTCCTCTCCATCACCACATCAATAACCCTTTGCGTCGCCACGAGTGGTCCTCCAATGAT
CGCCACTGGACCCGTAGCCGTCTAGATCGTGAACGCGCCGACTTCTTCGACACAAGGGTCGCGGGTCAGCCGCAC
ATATGGCAGACCATCCATGCCGCCCTCCAGGTTCTCGACCAGCTGCCCATGGCTGACGACTCTAACGATGACTAC
CATGATGCCCTAGCCACCGCCCAATCTATCCTCTCCGCCGCAGACATCTCCATCCCTACGGGCGATTTGGCCAAT
GGCGTCTACGACTCCTTGGGAAACTACTACAAGCTCCCGTGCTGGGTCGTCGCCGATCCCACCAACCTGGCCATC
GACTCAGATGCCCATCCTAAAGACAGCTCTCCCATGGATACTGACCAAGCGGACTCGGACGATGCTGCGAGGAGG
CGAGCCGAGAAGGGCAAGGCTGTCGTTCATCTCCACGAACACGTCGTCCTACGCGCCCGTCTCAGCGAGACAGGC
CGCGACATCGAGCTCGCCGTCAATAAGGCCGAACTGGTTCGCGCCGTGGCCGTTGGCCTCGCATTTAAGGCAGCC
CTGCCGTCGAACAAAAAGATTCGCCTCGCCTACATGGGTAAGATGCTCAAGGACAGTTCATCACTCGAGTCCCAG
GGCTGGCAGAGCGGCCACGTGGTCAATGCCTTCGTTTTTCCCCGATAG
Transcript >Ophcf2|04717
ATGGGCTGCTGCCTCTCCAGCTCAGCTGGCCCCAATTCGCCATATCCCGGCGGCGGCCACAACGCCTCCTCCGCT
CATCACATCAATCCGCCCTCTGTTGCCGCCCCCGAAGCGCCTCCCCCTGGTCCCTCGACTCCGGGCCGTCATCGT
CGCCACCGTGATGCAAGTCCTCTCCATCACCACATCAATAACCCTTTGCGTCGCCACGAGTGGTCCTCCAATGAT
CGCCACTGGACCCGTAGCCGTCTAGATCGTGAACGCGCCGACTTCTTCGACACAAGGGTCGCGGGTCAGCCGCAC
ATATGGCAGACCATCCATGCCGCCCTCCAGGTTCTCGACCAGCTGCCCATGGCTGACGACTCTAACGATGACTAC
CATGATGCCCTAGCCACCGCCCAATCTATCCTCTCCGCCGCAGACATCTCCATCCCTACGGGCGATTTGGCCAAT
GGCGTCTACGACTCCTTGGGAAACTACTACAAGCTCCCGTGCTGGGTCGTCGCCGATCCCACCAACCTGGCCATC
GACTCAGATGCCCATCCTAAAGACAGCTCTCCCATGGATACTGACCAAGCGGACTCGGACGATGCTGCGAGGAGG
CGAGCCGAGAAGGGCAAGGCTGTCGTTCATCTCCACGAACACGTCGTCCTACGCGCCCGTCTCAGCGAGACAGGC
CGCGACATCGAGCTCGCCGTCAATAAGGCCGAACTGGTTCGCGCCGTGGCCGTTGGCCTCGCATTTAAGGCAGCC
CTGCCGTCGAACAAAAAGATTCGCCTCGCCTACATGGGTAAGATGCTCAAGGACAGTTCATCACTCGAGTCCCAG
GGCTGGCAGAGCGGCCACGTGGTCAATGCCTTCGTTTTTCCCCGATAG
Gene >Ophcf2|04717
ATGGTCAGTAGCTGAACGCGGGCCCTGCCTAGGTTTGCCACCTGACGCGCCTTCGTCTGATCCAATAGGGCTGCT
GCCTCTCCAGCTCAGCTGGCCCCAATTCGCCATATCCCGGCGGCGGCCACAACGCCTCCTCCGCTCATCACATCA
ATCCGCCCTCTGTTGCCGCCCCCGAAGCGCCTCCCCCTGGTCCCTCGACTCCGGGCCGTCATCGTCGCCACCGTG
ATGCAAGTCCTCTCCATCACCACATCAATAACCCTTTGCGTCGCCACGAGTGGTCCTCCAATGATCGCCACTGGA
CCCGTAGCCGTCTAGATCGTGAACGCGCCGACTTCTTCGACACAAGGGTCGCGGGTCAGCCGCACATATGGCAGA
CCATCCATGCCGCCCTCCAGGTTCTCGACCAGCTGCCCATGGCTGACGACTCTAACGATGACTACCATGATGCCC
TAGCCACCGCCCAATCTATCCTCTCCGCCGCAGACATCTCCATCCCTACGGGCGATTTGGCCAATGGCGTCTACG
ACTCCTTGGGAAACTACTACAAGCTCCCGTGCTGGGTCGTCGCCGATCCCACCAACCTGGCCATCGACTCAGATG
CCCATCCTAAAGACAGCTCTCCCATGGATACTGACCAAGCGGACTCGGACGATGCTGCGAGGAGGCGAGCCGAGA
AGGGCAAGGCTGTCGTTCATCTCCACGAACACGTCGTCCTACGCGCCCGTCTCAGCGAGACAGGCCGCGACATCG
AGCTCGCCGTCAATAAGGCCGAACTGGTTCGCGCCGTGGCCGTTGGCCTCGCATTTAAGGCAGCCGTACGTTGGG
AGCTTCCCTTACTTCCTGCTTACTGGGTCCTTGCGCCTAATAGCTCATGGTGCAGCTGCCGTCGAACAAAAAGAT
TCGCCTCGCCTACATGGGTAAGATGCTCAAGGACAGTTCATCACTCGAGTCCCAGGGCTGGCAGAGCGGCCACGT
GGTCAATGCCTTCGTTTTTCCCCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail