Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04715
Gene name
Locationscaffold_05:563618..564383
Strand-
Gene length (bp)765
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02792 Mago_nashi Mago nashi protein 1.3E-71 8 154

GO

GO Term Description Terminal node
GO:0035145 exon-exon junction complex Yes
GO:0008380 RNA splicing Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6837 0.5587 0.0568 0.0376 0.2086 0.0122 0.1604 0.2064 0.1581 0.0329

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6503
Ophiocordyceps australis map64 (Brazil) OphauB2|8075
Ophiocordyceps camponoti-floridani Ophcf2|04715 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6400
Ophiocordyceps kimflemingae Ophio5|6179
Ophiocordyceps subramaniannii Hirsu2|9112

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04715
MSTTNEPFYLRYYSGHMGRFGHEFLEFDFRVVGDGRSAVTRYANNSNYRNDSLIRKEMCISSALVDEVKRIIRAS
EIIKEDDSKWPQKNKDGRQELEIRLGNDHISFETAKIGSLVDVTESADPEGMRVFYYLVQDLKALVFSLIALHFK
IKPI*
Coding >Ophcf2|04715
ATGTCTACGACTAACGAGCCTTTTTACCTACGGTATTATTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTT
GAGTTCGACTTTAGGGTCGTCGGCGACGGTCGTAGCGCCGTGACACGATATGCCAACAATTCCAACTATCGGAAC
GACAGCCTCATCAGGAAAGAAATGTGCATCAGCTCGGCGCTTGTGGATGAGGTCAAGCGCATAATCCGGGCGAGC
GAAATCATTAAGGAGGACGACTCCAAGTGGCCGCAAAAGAACAAGGACGGACGACAAGAACTCGAAATTCGACTA
GGAAACGATCACATTTCCTTCGAGACGGCTAAGATTGGCTCTTTAGTCGACGTCACGGAATCTGCCGATCCGGAA
GGCATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTCAGCCTAATTGCTCTTCATTTTAAG
ATTAAGCCTATCTAA
Transcript >Ophcf2|04715
ATGTCTACGACTAACGAGCCTTTTTACCTACGGTATTATTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTT
GAGTTCGACTTTAGGGTCGTCGGCGACGGTCGTAGCGCCGTGACACGATATGCCAACAATTCCAACTATCGGAAC
GACAGCCTCATCAGGAAAGAAATGTGCATCAGCTCGGCGCTTGTGGATGAGGTCAAGCGCATAATCCGGGCGAGC
GAAATCATTAAGGAGGACGACTCCAAGTGGCCGCAAAAGAACAAGGACGGACGACAAGAACTCGAAATTCGACTA
GGAAACGATCACATTTCCTTCGAGACGGCTAAGATTGGCTCTTTAGTCGACGTCACGGAATCTGCCGATCCGGAA
GGCATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTCAGCCTAATTGCTCTTCATTTTAAG
ATTAAGCCTATCTAA
Gene >Ophcf2|04715
ATGTCTACGACTAACGAGCCTTTTTACCTACGGTATTAGTGAGTGGTGGCTGACGACGCCGACAGAGCGGGTCAC
TGCCATGCTAACAAGACCGAAACAGTTCTGGGCACATGGGTCGGTTTGGCCATGAATTTCTTGGTAAAGCGATCC
TGGCCGTTTCATAGGAGGTTTCTCACCCGAGTCTTTGCAGAGTTCGACTTTAGGGTCGTCGGCGACGGTCGTAGC
GCCGTGACACGATATGCCAACAATTCCAACTATCGGAACGACAGCCTCATCAGGAAAGAAAGTACGAACAAGGAC
TCTGTGAGCGCACAGGCGATGGCGTGCCGGTCTCGCCTACAGACTTGTGAACAACTTTCTAAAACTCGAGTAGTG
TGCATCAGCTCGGCGCTTGTGGATGAGGTCAAGCGCATAATCCGGGCGAGCGAAATCATTAAGTAAGTCAAACAT
GGTGTTCTGTTATTTGCGACGCTGACCTTGTCAAGGGAGGACGACTCCAAGTGGCCGCAAAAGAACAAGGACGGA
CGACAAGAACTCGAAATTCGACTAGGAAACGATCACATTTCCTTCGAGGTCAGCGTTCTAGATGATCTGGATTAG
AAGTCAGGGTTGACAATCAGACAGACGGCTAAGATTGGCTCTTTAGTCGACGTCACGGAATCTGCCGATCCGGAA
GGCATGCGCGTGTTTTACTACCTCGTGCAGGATCTCAAGGCGCTTGTTTTCAGCCTAATTGCTCTTCATTTTAAG
ATTAAGCCTATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail