Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04706
Gene name
Locationscaffold_05:362724..364558
Strand-
Gene length (bp)1834
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 5.2E-118 63 511
PF13520 AA_permease_2 Amino acid permease 2.3E-27 67 476

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 89 108 19
3 144 166 22
4 170 192 22
5 199 221 22
6 249 271 22
7 292 314 22
8 344 366 22
9 386 405 19
10 415 437 22
11 458 480 22
12 490 512 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04706
MFHGLKIEAVGDKLSTEPRPVPKARNDETPRYGASESASMRDGSDGSLRDPDSGVRRGLKNRHLSMMALAGIIGP
GLLVGAGGALNSGGPASLLIGFAVLGVIAFVVMQSLGEITTLFPGGGSFISLAERMVDKSFSVAIGWNYFVIWAA
VLANEYNVICSILTYWAPAVPLWAFFLILWALFCGFQLLGVEAFGEAEFWLALLKMLGLTAYFVFAIVYAAGGIS
GQAEPVGFRYWHDPGAFNGNGFRGVAIVFVFCSTFYAGIESVAVAATEARNPGAAVPQAIRQVFWRILFVYMGSA
IFFGITCPANALGLVDGGSKALQSPMTIAIHNAGWEGGVHLINTFILITCLSAINSSIYIGSRTLLYMAQSGKAP
SIIGWTNRRGVPVWAIVITNAFGSIAMMNVSTGASKAYDYIVNLSGVSTFIVWGGISLIHMRFRRAWAIQGRSLD
EIPFRSKWYPSIAYFGLCANVFLALVQGWTSLYPFNAGKFVDAYILLPLCGLIYGACKLYWQGRDKLKRSWEIDL
DSGRRTDLDKTETSAEVGSTKFTEQTPLWKRVWNRL*
Coding >Ophcf2|04706
ATGTTCCATGGCCTCAAGATCGAGGCCGTCGGCGACAAGTTGTCGACAGAGCCGCGACCCGTCCCAAAAGCCCGA
AACGACGAGACCCCCCGCTACGGCGCCAGCGAGTCCGCCAGCATGCGGGACGGCAGTGACGGAAGTCTCAGGGAT
CCGGACTCTGGTGTTCGCCGTGGCCTCAAGAACAGGCATCTGTCCATGATGGCCCTGGCCGGCATTATTGGACCG
GGCCTCCTCGTTGGCGCTGGCGGTGCGCTGAACAGCGGGGGGCCGGCCTCATTGCTCATCGGCTTCGCCGTTCTC
GGCGTCATCGCCTTCGTCGTCATGCAATCTCTCGGCGAGATCACTACCCTCTTCCCCGGCGGCGGCTCATTCATC
TCCCTGGCTGAGCGCATGGTCGACAAGTCCTTCTCCGTTGCTATCGGCTGGAACTACTTCGTCATCTGGGCTGCC
GTCCTAGCCAACGAGTACAACGTCATATGCAGCATCCTCACCTACTGGGCGCCAGCCGTTCCCCTTTGGGCCTTC
TTCCTCATCCTCTGGGCCCTCTTCTGCGGCTTCCAGCTGCTCGGCGTCGAGGCCTTTGGCGAGGCTGAGTTCTGG
CTGGCCCTGCTGAAGATGCTCGGCCTCACCGCCTACTTCGTCTTTGCCATTGTCTACGCTGCTGGTGGCATCTCC
GGCCAGGCCGAGCCCGTCGGCTTCCGCTACTGGCACGATCCTGGCGCCTTCAACGGAAACGGCTTCCGCGGCGTT
GCTATCGTCTTCGTCTTTTGTTCCACCTTTTATGCCGGCATTGAGTCCGTCGCCGTCGCCGCTACCGAGGCCCGG
AACCCCGGCGCTGCCGTACCTCAGGCCATCCGTCAGGTCTTTTGGCGCATTCTCTTCGTTTACATGGGCTCCGCC
ATCTTCTTCGGAATTACCTGCCCGGCCAATGCCCTGGGTTTGGTTGACGGCGGCTCAAAGGCCCTTCAGAGCCCA
ATGACAATTGCCATCCATAACGCTGGGTGGGAAGGAGGGGTACATCTGATTAACACCTTCATATTGATCACCTGC
CTGTCCGCCATAAACTCGTCCATTTACATCGGCTCTCGCACACTCCTATATATGGCCCAGTCTGGGAAGGCTCCG
TCCATCATCGGCTGGACCAATCGAAGAGGGGTTCCCGTGTGGGCTATTGTCATAACTAACGCTTTTGGCTCCATC
GCTATGATGAACGTCTCGACGGGGGCGTCCAAGGCGTACGACTACATTGTCAACCTGTCGGGTGTCAGCACCTTC
ATCGTCTGGGGCGGCATTAGCCTCATCCACATGCGCTTCCGTCGCGCCTGGGCCATTCAGGGCCGTAGCCTAGAT
GAGATACCGTTTCGAAGCAAATGGTACCCGTCCATTGCCTACTTTGGGCTCTGCGCCAACGTCTTCCTGGCATTA
GTTCAGGGCTGGACGAGCCTGTACCCGTTCAACGCCGGCAAATTTGTCGATGCCTACATCCTCCTCCCGCTCTGC
GGTCTCATCTACGGCGCCTGTAAGTTGTACTGGCAGGGGCGGGACAAGTTGAAACGTAGCTGGGAGATCGACCTC
GACAGCGGCCGGCGAACAGACCTGGACAAGACAGAGACGTCCGCTGAGGTCGGGTCTACTAAGTTTACTGAGCAA
ACTCCGCTGTGGAAGAGGGTTTGGAACCGGCTTTAG
Transcript >Ophcf2|04706
ATGTTCCATGGCCTCAAGATCGAGGCCGTCGGCGACAAGTTGTCGACAGAGCCGCGACCCGTCCCAAAAGCCCGA
AACGACGAGACCCCCCGCTACGGCGCCAGCGAGTCCGCCAGCATGCGGGACGGCAGTGACGGAAGTCTCAGGGAT
CCGGACTCTGGTGTTCGCCGTGGCCTCAAGAACAGGCATCTGTCCATGATGGCCCTGGCCGGCATTATTGGACCG
GGCCTCCTCGTTGGCGCTGGCGGTGCGCTGAACAGCGGGGGGCCGGCCTCATTGCTCATCGGCTTCGCCGTTCTC
GGCGTCATCGCCTTCGTCGTCATGCAATCTCTCGGCGAGATCACTACCCTCTTCCCCGGCGGCGGCTCATTCATC
TCCCTGGCTGAGCGCATGGTCGACAAGTCCTTCTCCGTTGCTATCGGCTGGAACTACTTCGTCATCTGGGCTGCC
GTCCTAGCCAACGAGTACAACGTCATATGCAGCATCCTCACCTACTGGGCGCCAGCCGTTCCCCTTTGGGCCTTC
TTCCTCATCCTCTGGGCCCTCTTCTGCGGCTTCCAGCTGCTCGGCGTCGAGGCCTTTGGCGAGGCTGAGTTCTGG
CTGGCCCTGCTGAAGATGCTCGGCCTCACCGCCTACTTCGTCTTTGCCATTGTCTACGCTGCTGGTGGCATCTCC
GGCCAGGCCGAGCCCGTCGGCTTCCGCTACTGGCACGATCCTGGCGCCTTCAACGGAAACGGCTTCCGCGGCGTT
GCTATCGTCTTCGTCTTTTGTTCCACCTTTTATGCCGGCATTGAGTCCGTCGCCGTCGCCGCTACCGAGGCCCGG
AACCCCGGCGCTGCCGTACCTCAGGCCATCCGTCAGGTCTTTTGGCGCATTCTCTTCGTTTACATGGGCTCCGCC
ATCTTCTTCGGAATTACCTGCCCGGCCAATGCCCTGGGTTTGGTTGACGGCGGCTCAAAGGCCCTTCAGAGCCCA
ATGACAATTGCCATCCATAACGCTGGGTGGGAAGGAGGGGTACATCTGATTAACACCTTCATATTGATCACCTGC
CTGTCCGCCATAAACTCGTCCATTTACATCGGCTCTCGCACACTCCTATATATGGCCCAGTCTGGGAAGGCTCCG
TCCATCATCGGCTGGACCAATCGAAGAGGGGTTCCCGTGTGGGCTATTGTCATAACTAACGCTTTTGGCTCCATC
GCTATGATGAACGTCTCGACGGGGGCGTCCAAGGCGTACGACTACATTGTCAACCTGTCGGGTGTCAGCACCTTC
ATCGTCTGGGGCGGCATTAGCCTCATCCACATGCGCTTCCGTCGCGCCTGGGCCATTCAGGGCCGTAGCCTAGAT
GAGATACCGTTTCGAAGCAAATGGTACCCGTCCATTGCCTACTTTGGGCTCTGCGCCAACGTCTTCCTGGCATTA
GTTCAGGGCTGGACGAGCCTGTACCCGTTCAACGCCGGCAAATTTGTCGATGCCTACATCCTCCTCCCGCTCTGC
GGTCTCATCTACGGCGCCTGTAAGTTGTACTGGCAGGGGCGGGACAAGTTGAAACGTAGCTGGGAGATCGACCTC
GACAGCGGCCGGCGAACAGACCTGGACAAGACAGAGACGTCCGCTGAGGTCGGGTCTACTAAGTTTACTGAGCAA
ACTCCGCTGTGGAAGAGGGTTTGGAACCGGCTTTAG
Gene >Ophcf2|04706
ATGTTCCATGGCCTCAAGATCGAGGCCGTCGGCGACAAGTTGTCGACAGAGCCGCGACCCGTCCCAAAAGCCCGA
AACGACGAGACCCCCCGCTACGGCGCCAGCGAGTCCGCCAGCATGCGGGACGGCAGTGACGGAAGTCTCAGGGAT
CCGGACTCTGGTGTTCGCCGTGGCCTCAAGAACAGGCATCTGTCCATGATGGCCCTGGCCGGCATTATTGGACCG
GGCCTCCTCGTTGGCGCTGGCGGTGCGCTGAACAGCGGGGGGCCGGCCTCATTGCTCATCGGCTTCGCCGTTCTC
GGTATATCTTTCACTTTATTTTTCCCCCTCTCCTCTTTTCTTGCTCACTTCTTCAACCCGTCTATGTCGTGCAAA
TTGATGACTGACAGCTCAGTATTCAGGCGTCATCGCCTTCGTCGTCATGCAATCTCTCGGCGAGATCACTACCCT
CTTCCCCGGCGGCGGCTCATTCATCTCCCTGGCTGAGCGCATGGTCGACAAGTCCTTCTCCGTTGCTATCGGCTG
GAACTACTTCGTCATCTGGGCTGCCGTCCTAGCCAACGAGTACAACGTCATATGCAGCATCCTCACCTACTGGGC
GCCAGCCGTTCCCCTTTGGGCCTTCTTCCTCATCCTCTGGGCCCTCTTCTGCGGCTTCCAGCTGCTCGGCGTCGA
GGCCTTTGGCGAGGCTGAGTTCTGGCTGGCCCTGCTGAAGATGCTCGGCCTCACCGCCTACTTCGTCTTTGCCAT
TGTCTACGCTGCTGGTGGCATCTCCGGCCAGGCCGAGCCCGTCGGCTTCCGCTACTGGCACGATCCTGGCGCCTT
CAACGGAAACGGCTTCCGCGGCGTTGCTATCGTCTTCGTCTTTTGTTCCACCTTTTATGCCGGCATTGAGTCCGT
CGCCGTCGCCGCTACCGAGGCCCGGAACCCCGGCGCTGCCGTACCTCAGGCCATCCGTCAGGTCTTTTGGCGCAT
TCTCTTCGTTTACATGGGCTCCGCCATCTTCTTCGGAATTACCTGCCCGGCCAATGCCCTGGGTTTGGTTGACGG
CGGCTCAAAGGCCCTTCAGAGCCCAATGACAATTGCCATCCATAACGCTGGGTGGGAAGGAGGTTGGTGCTGTTT
TACTTAACCGCACGTTTAGGCTGACTTGGCTTCAGGGGTACATCTGATTAACACCTTCATATTGATCACCTGCCT
GTCCGCCATAAACTCGTCCATTTACATCGGCTCTCGCACACTCCTATATATGGCCCAGTCTGGGAAGGCTCCGTC
CATCATCGGCTGGACCAATCGAAGAGGGGTTCCCGTGTGGGCTATTGTCATAACTAACGCTTTTGGCTCCATCGC
TATGATGAACGTCTCGACGGGGGCGTCCAAGGCGTACGACTACATTGTCAACCTGTCGGGTGTCAGCACCTTCAT
CGTCTGGGGCGGCATTAGCCTCATCCACATGCGCTTCCGTCGCGCCTGGGCCATTCAGGGCCGTAGCCTAGATGA
GATACCGTTTCGAAGCAAATGGTACCCGTCCATTGCCTACTTTGGGCTCTGCGCCAACGTCTTCCTGGCATTAGT
TCAGGGCTGGACGAGCCTGTACCCGTTCAACGCCGGCAAATTTGTCGATGCCTACATCCTCCTCCCGCTCTGCGG
TCTCATCTACGGCGCCTGTAAGTTGTACTGGCAGGGGCGGGACAAGTTGAAACGTAGCTGGGAGATCGACCTCGA
CAGCGGCCGGCGAACAGACCTGGACAAGACAGAGACGTCCGCTGAGGTCGGGTCTACTAAGTTTACTGAGCAAAC
TCCGCTGTGGAAGAGGGTTTGGAACCGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail