Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04705
Gene name
Locationscaffold_05:261604..265595
Strand-
Gene length (bp)3991
Transcript length (bp)3870
Coding sequence length (bp)3870
Protein length (aa) 1290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 3.4E-17 388 498
PF13857 Ank_5 Ankyrin repeats (many copies) 6.9E-12 848 903

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Nuclear export signal 0.4454 0.4901 0.2004 0.0506 0.1326 0.0135 0.2325 0.7277 0.4143 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4182
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|524
Ophiocordyceps australis map64 (Brazil) OphauB2|3804
Ophiocordyceps camponoti-floridani Ophcf2|04705 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6410
Ophiocordyceps kimflemingae Ophio5|4435
Ophiocordyceps subramaniannii Hirsu2|8494

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04705
MQPLNPFLAAFFRSSVVAQCSPVHHYVLLVPLTDLLFTYRETEYGGSVADLVASDDFLNSHVLRIPPPVKDRDAA
AANLRDVRGKPKKYSTLNGRSVLVRDSIVFTNKGFKTLAQAQILSDATWYPDVLEPRQWLLYYISKPLVGTWEEV
KLSPAVLVNGIKGKETKGLEQSKTQAVESSTENAVPRKKDVRTFDDLLENFPMIARQMQAGLERLFLEFSAVFEK
PLPPPPSASDIPDPQPMGPIEAAAKRARSESLGLRNGDRAPAKLPVMENFYAEDDEDVMRAALETAVTTAIDLFQ
GVDKQQLSLLGATTDLTGPLVEKLIERYVSDNVHHLLFPKLAVLKRPDDLLLEARIRKMEFIDVSQLGIAIDGGP
RAKLDLLIQLGPVADEFKKISAARSPGDMMDTLLATTKAVSRLAPASGVASGGRESAASEKPMLTANADTLVSLL
LFVVIRSQIRNLQARIAYVRNFIFVDDIESGEMGYALSTFEAVLAYLLLDSTGLYKASRRNKALWEATKKADLAE
LRNIMELSTSAIDNCGGDYNDLFGEGEENGAIEGDGSRSPLKPCRRPSLTAWNLVNGLSVTPLLGTIVSDRFSHG
SDLSHVFPFQANGDDLPIPVKRIKRVAMDTRSMSSGSEISFQSRTTSLGTNSSAIEGDISVAKLAQTTDALGQSV
LMMAVQHRQTAALAYLLSLSGYYPIDVVLQDMDVERTTLLSAATQLGHAELIDMVLNYIVSQASVPQLSRYLSEQ
DVRGRSVGHYLFHAPWLIRRIGHMIAWRQRDKNGQTPLFALCRSYDHADYHSMVEAGLAAARESQGDGQALHVDD
HVDGKGNTLLHIINDARLATRILQHGDVDVNATNERRFTALMVASKYGRYDMVRCLFADSRVDVAARELRGLTAV
ELAKDDEVRNKIDDLGLFRTPAGRDGRITGVVRAFFVEDGSVRLVLKSAAPTDRDSYTVTTSRRSLAELERMAQL
LALEHPASWIPTLAEMRSPFQLPTKPSRALLRDIQLHADWFLRIMLGHPTLATHEMLWEFFLVPELQLDAMEQRT
RLKLETRRDKIKDEYEPVEDVGEVERFASHARDMVRSVGFSTKGVARRVNAVGLSASDLYDSMVLLHRQVSAVHF
MPRSHVDAFEFYVRAVAPAQSSAQAGLHTTLLAMQSTVQALLSSLSRPGLLIERYWAAWSEANRQASSGARSSRW
PLGILDETRQRLLDGREQRVRRLRDEAEEAARELRYTQQTVAAELAGWQEMHESMGRRAMREYARAMVVQERMRL
SGMMRALRRVRRDK*
Coding >Ophcf2|04705
ATGCAACCGCTCAATCCCTTTCTGGCAGCCTTCTTCAGAAGCTCCGTCGTCGCCCAGTGCTCGCCCGTCCATCAC
TATGTTCTCCTCGTGCCGTTGACCGATCTTCTCTTTACATACCGCGAGACAGAATATGGCGGCTCTGTCGCTGAT
CTAGTCGCCTCGGATGACTTTCTGAACAGCCACGTGCTACGCATACCGCCCCCGGTCAAGGATAGAGACGCGGCC
GCAGCGAATTTGCGCGATGTAAGGGGCAAGCCAAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACTAACAAAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTCAGTGACGCTACCTGGTAC
CCCGACGTTCTGGAGCCTCGGCAATGGCTGTTATACTACATCTCCAAGCCCCTAGTGGGCACCTGGGAGGAGGTC
AAACTGTCACCAGCCGTCCTTGTCAACGGAATCAAGGGAAAGGAGACGAAGGGTCTCGAGCAGAGCAAGACGCAA
GCTGTGGAGTCTTCGACCGAAAACGCCGTCCCGCGCAAAAAGGATGTTCGTACCTTTGACGACTTATTGGAAAAC
TTCCCCATGATCGCTCGGCAGATGCAGGCTGGCCTCGAAAGGCTGTTTCTTGAATTCTCCGCCGTCTTTGAGAAG
CCCTTACCTCCTCCTCCCTCCGCCTCTGACATACCCGATCCGCAGCCAATGGGCCCTATTGAGGCCGCGGCCAAG
AGGGCCCGCTCTGAAAGTCTCGGACTGAGGAACGGCGACAGGGCTCCCGCCAAGCTGCCCGTTATGGAGAACTTT
TACGCCGAAGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACCGCTGTCACAACCGCTATCGACCTCTTCCAG
GGCGTCGACAAGCAACAGCTGTCTCTCCTCGGCGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATT
GAACGCTACGTCTCCGACAATGTTCATCATCTGCTCTTTCCCAAGCTCGCCGTCCTCAAGCGACCCGACGATCTG
CTGCTCGAAGCCAGGATAAGAAAAATGGAGTTCATTGACGTGTCGCAACTGGGCATTGCCATCGACGGCGGCCCG
AGGGCTAAACTTGATCTGCTCATCCAGTTAGGGCCCGTTGCTGACGAGTTCAAGAAGATCTCAGCCGCCCGAAGC
CCTGGGGACATGATGGACACCCTGTTGGCAACCACTAAGGCTGTCTCCCGCTTGGCTCCAGCATCCGGTGTGGCG
AGTGGTGGCCGAGAGTCGGCGGCGTCAGAAAAGCCCATGCTTACTGCCAATGCCGATACGCTCGTTTCCCTCCTA
CTCTTTGTCGTCATCCGTTCCCAGATTCGCAATTTGCAGGCACGAATCGCCTACGTGCGCAATTTCATCTTTGTT
GACGACATCGAGAGTGGAGAGATGGGTTACGCCTTGAGCACCTTTGAGGCTGTGCTGGCATACTTGCTTCTGGAC
TCGACAGGCTTATACAAGGCCAGCAGGAGGAACAAGGCCTTGTGGGAGGCGACAAAGAAGGCTGATCTGGCAGAA
CTGAGAAACATTATGGAGCTGAGCACGTCGGCCATTGATAATTGCGGGGGAGATTACAACGATCTGTTCGGCGAA
GGCGAGGAAAACGGAGCAATCGAGGGTGATGGATCGCGAAGTCCCCTGAAGCCCTGCCGGCGCCCCTCGTTGACG
GCTTGGAACCTCGTCAATGGCTTGTCCGTAACGCCATTGCTGGGTACCATCGTCTCGGACCGGTTTTCACACGGC
TCAGACCTCAGCCACGTCTTCCCCTTTCAGGCGAATGGCGACGACCTGCCGATTCCTGTTAAGAGGATCAAGAGG
GTGGCCATGGACACCAGAAGCATGTCGAGCGGGTCCGAAATATCGTTCCAGTCCCGCACGACGAGCCTAGGAACC
AATAGTAGCGCCATTGAGGGCGACATATCGGTGGCAAAGCTGGCCCAGACAACCGACGCTTTGGGCCAGTCGGTG
CTGATGATGGCGGTACAGCACAGGCAGACAGCCGCCTTGGCGTATCTGCTGAGTCTTTCGGGCTACTACCCGATC
GACGTAGTTCTGCAGGACATGGATGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCAGAG
CTGATCGACATGGTCCTGAATTACATCGTGTCCCAAGCTTCGGTGCCGCAGCTCTCGCGGTACCTATCGGAACAG
GACGTCCGGGGCCGCAGTGTGGGCCACTATCTTTTCCACGCGCCCTGGCTCATCCGACGGATCGGCCACATGATA
GCGTGGCGGCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCCCTGTGCCGGTCCTACGATCATGCGGATTAC
CACAGTATGGTCGAGGCCGGGCTGGCGGCGGCGCGAGAATCGCAGGGCGACGGGCAGGCGCTGCACGTGGACGAC
CATGTTGACGGCAAGGGAAACACGCTTCTGCACATCATTAACGATGCGAGGCTTGCGACGCGGATCCTGCAGCAC
GGCGACGTCGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGGTAC
GACATGGTGCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGTTACGCGGGCTGACGGCGGTC
GAGCTGGCCAAGGATGACGAAGTGCGCAACAAGATCGACGACCTGGGCCTGTTCAGAACGCCGGCCGGACGCGAC
GGGCGTATTACGGGCGTGGTGCGGGCCTTTTTCGTTGAGGACGGAAGCGTGCGGCTAGTGCTCAAGTCGGCGGCG
CCGACGGACCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGTATGGCGCAGCTG
CTGGCGCTCGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCCTTTCAACTGCCGACGAAG
CCGTCGCGGGCCCTGCTACGCGACATACAGCTCCATGCCGACTGGTTTCTGCGCATCATGCTGGGACACCCGACG
CTAGCGACGCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCTGAGCTGCAGCTTGACGCCATGGAGCAGCGGACG
CGGCTCAAGCTGGAGACAAGACGCGACAAGATCAAGGACGAGTACGAGCCTGTGGAAGACGTGGGCGAGGTGGAG
CGATTTGCTAGCCACGCGAGAGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTGAAT
GCCGTGGGACTGTCGGCCTCAGATTTGTACGACTCAATGGTGTTGCTGCACAGACAGGTGTCGGCGGTGCACTTC
ATGCCACGCTCGCATGTGGACGCGTTCGAGTTCTACGTCAGGGCCGTGGCGCCGGCGCAGTCGAGCGCACAAGCG
GGGCTGCATACGACGTTGCTGGCGATGCAGTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCTGGGCTG
CTGATCGAGCGATACTGGGCGGCGTGGAGCGAGGCGAACCGTCAGGCGAGTTCGGGGGCGCGGTCGTCCCGGTGG
CCGCTCGGGATCCTTGATGAGACGCGACAGAGGCTCCTAGATGGGCGGGAGCAGCGAGTGCGGCGGCTGCGGGAC
GAGGCCGAGGAGGCGGCGCGCGAGCTGCGGTACACGCAGCAGACGGTGGCTGCCGAGCTGGCCGGGTGGCAGGAG
ATGCACGAGAGCATGGGCAGGCGGGCGATGCGCGAGTACGCGCGGGCCATGGTGGTGCAGGAGCGGATGAGGCTC
AGCGGGATGATGCGTGCCCTGAGGAGGGTGAGGCGCGACAAATGA
Transcript >Ophcf2|04705
ATGCAACCGCTCAATCCCTTTCTGGCAGCCTTCTTCAGAAGCTCCGTCGTCGCCCAGTGCTCGCCCGTCCATCAC
TATGTTCTCCTCGTGCCGTTGACCGATCTTCTCTTTACATACCGCGAGACAGAATATGGCGGCTCTGTCGCTGAT
CTAGTCGCCTCGGATGACTTTCTGAACAGCCACGTGCTACGCATACCGCCCCCGGTCAAGGATAGAGACGCGGCC
GCAGCGAATTTGCGCGATGTAAGGGGCAAGCCAAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACTAACAAAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTCAGTGACGCTACCTGGTAC
CCCGACGTTCTGGAGCCTCGGCAATGGCTGTTATACTACATCTCCAAGCCCCTAGTGGGCACCTGGGAGGAGGTC
AAACTGTCACCAGCCGTCCTTGTCAACGGAATCAAGGGAAAGGAGACGAAGGGTCTCGAGCAGAGCAAGACGCAA
GCTGTGGAGTCTTCGACCGAAAACGCCGTCCCGCGCAAAAAGGATGTTCGTACCTTTGACGACTTATTGGAAAAC
TTCCCCATGATCGCTCGGCAGATGCAGGCTGGCCTCGAAAGGCTGTTTCTTGAATTCTCCGCCGTCTTTGAGAAG
CCCTTACCTCCTCCTCCCTCCGCCTCTGACATACCCGATCCGCAGCCAATGGGCCCTATTGAGGCCGCGGCCAAG
AGGGCCCGCTCTGAAAGTCTCGGACTGAGGAACGGCGACAGGGCTCCCGCCAAGCTGCCCGTTATGGAGAACTTT
TACGCCGAAGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACCGCTGTCACAACCGCTATCGACCTCTTCCAG
GGCGTCGACAAGCAACAGCTGTCTCTCCTCGGCGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATT
GAACGCTACGTCTCCGACAATGTTCATCATCTGCTCTTTCCCAAGCTCGCCGTCCTCAAGCGACCCGACGATCTG
CTGCTCGAAGCCAGGATAAGAAAAATGGAGTTCATTGACGTGTCGCAACTGGGCATTGCCATCGACGGCGGCCCG
AGGGCTAAACTTGATCTGCTCATCCAGTTAGGGCCCGTTGCTGACGAGTTCAAGAAGATCTCAGCCGCCCGAAGC
CCTGGGGACATGATGGACACCCTGTTGGCAACCACTAAGGCTGTCTCCCGCTTGGCTCCAGCATCCGGTGTGGCG
AGTGGTGGCCGAGAGTCGGCGGCGTCAGAAAAGCCCATGCTTACTGCCAATGCCGATACGCTCGTTTCCCTCCTA
CTCTTTGTCGTCATCCGTTCCCAGATTCGCAATTTGCAGGCACGAATCGCCTACGTGCGCAATTTCATCTTTGTT
GACGACATCGAGAGTGGAGAGATGGGTTACGCCTTGAGCACCTTTGAGGCTGTGCTGGCATACTTGCTTCTGGAC
TCGACAGGCTTATACAAGGCCAGCAGGAGGAACAAGGCCTTGTGGGAGGCGACAAAGAAGGCTGATCTGGCAGAA
CTGAGAAACATTATGGAGCTGAGCACGTCGGCCATTGATAATTGCGGGGGAGATTACAACGATCTGTTCGGCGAA
GGCGAGGAAAACGGAGCAATCGAGGGTGATGGATCGCGAAGTCCCCTGAAGCCCTGCCGGCGCCCCTCGTTGACG
GCTTGGAACCTCGTCAATGGCTTGTCCGTAACGCCATTGCTGGGTACCATCGTCTCGGACCGGTTTTCACACGGC
TCAGACCTCAGCCACGTCTTCCCCTTTCAGGCGAATGGCGACGACCTGCCGATTCCTGTTAAGAGGATCAAGAGG
GTGGCCATGGACACCAGAAGCATGTCGAGCGGGTCCGAAATATCGTTCCAGTCCCGCACGACGAGCCTAGGAACC
AATAGTAGCGCCATTGAGGGCGACATATCGGTGGCAAAGCTGGCCCAGACAACCGACGCTTTGGGCCAGTCGGTG
CTGATGATGGCGGTACAGCACAGGCAGACAGCCGCCTTGGCGTATCTGCTGAGTCTTTCGGGCTACTACCCGATC
GACGTAGTTCTGCAGGACATGGATGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCAGAG
CTGATCGACATGGTCCTGAATTACATCGTGTCCCAAGCTTCGGTGCCGCAGCTCTCGCGGTACCTATCGGAACAG
GACGTCCGGGGCCGCAGTGTGGGCCACTATCTTTTCCACGCGCCCTGGCTCATCCGACGGATCGGCCACATGATA
GCGTGGCGGCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCCCTGTGCCGGTCCTACGATCATGCGGATTAC
CACAGTATGGTCGAGGCCGGGCTGGCGGCGGCGCGAGAATCGCAGGGCGACGGGCAGGCGCTGCACGTGGACGAC
CATGTTGACGGCAAGGGAAACACGCTTCTGCACATCATTAACGATGCGAGGCTTGCGACGCGGATCCTGCAGCAC
GGCGACGTCGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGGTAC
GACATGGTGCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGTTACGCGGGCTGACGGCGGTC
GAGCTGGCCAAGGATGACGAAGTGCGCAACAAGATCGACGACCTGGGCCTGTTCAGAACGCCGGCCGGACGCGAC
GGGCGTATTACGGGCGTGGTGCGGGCCTTTTTCGTTGAGGACGGAAGCGTGCGGCTAGTGCTCAAGTCGGCGGCG
CCGACGGACCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGTATGGCGCAGCTG
CTGGCGCTCGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCCTTTCAACTGCCGACGAAG
CCGTCGCGGGCCCTGCTACGCGACATACAGCTCCATGCCGACTGGTTTCTGCGCATCATGCTGGGACACCCGACG
CTAGCGACGCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCTGAGCTGCAGCTTGACGCCATGGAGCAGCGGACG
CGGCTCAAGCTGGAGACAAGACGCGACAAGATCAAGGACGAGTACGAGCCTGTGGAAGACGTGGGCGAGGTGGAG
CGATTTGCTAGCCACGCGAGAGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTGAAT
GCCGTGGGACTGTCGGCCTCAGATTTGTACGACTCAATGGTGTTGCTGCACAGACAGGTGTCGGCGGTGCACTTC
ATGCCACGCTCGCATGTGGACGCGTTCGAGTTCTACGTCAGGGCCGTGGCGCCGGCGCAGTCGAGCGCACAAGCG
GGGCTGCATACGACGTTGCTGGCGATGCAGTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCTGGGCTG
CTGATCGAGCGATACTGGGCGGCGTGGAGCGAGGCGAACCGTCAGGCGAGTTCGGGGGCGCGGTCGTCCCGGTGG
CCGCTCGGGATCCTTGATGAGACGCGACAGAGGCTCCTAGATGGGCGGGAGCAGCGAGTGCGGCGGCTGCGGGAC
GAGGCCGAGGAGGCGGCGCGCGAGCTGCGGTACACGCAGCAGACGGTGGCTGCCGAGCTGGCCGGGTGGCAGGAG
ATGCACGAGAGCATGGGCAGGCGGGCGATGCGCGAGTACGCGCGGGCCATGGTGGTGCAGGAGCGGATGAGGCTC
AGCGGGATGATGCGTGCCCTGAGGAGGGTGAGGCGCGACAAATGA
Gene >Ophcf2|04705
ATGCAACCGCTCAATCCCTTTCTGGCAGCCTTCTTCAGAAGCTCCGTCGTCGCCCAGTGCTCGCCCGTCCATCAC
TATGTTCTCCTCGTGCCGTTGACCGATCTTCTCTTTACATACCGCGAGACAGAATATGGCGGCTCTGTCGCTGAT
CTAGTCGCCTCGGATGACTTTCTGAACAGCCACGTGCTACGCATACCGCCCCCGGTCAAGGATAGAGACGCGGCC
GCAGCGAATTTGCGCGATGTAAGGGGCAAGCCAAAGAAGTACTCTACCCTCAACGGCCGGAGCGTTCTAGTAAGG
GACTCCATCGTCTTCACTAACAAAGGTGCAGTCTTGCTACACCTCTCCACCCTCGCTGCGGCCACATAGCTGACA
AGCCATCCAATCCGCAGGCTTCAAGACGCTTGCCCAGGCTCAGATTCTCAGTGACGCTACCTGGTACCCCGACGT
TCTGGAGCCTCGGCAATGGCTGTTATACTACATCTCCAAGCCCCTAGTGGGCACCTGGGAGGAGGTCAAACTGTC
ACCAGCCGTCCTTGTCAACGGAATCAAGGGAAAGGAGACGAAGGGTCTCGAGCAGAGCAAGACGCAAGCTGTGGA
GTCTTCGACCGAAAACGCCGTCCCGCGCAAAAAGGATGTTCGTACCTTTGACGACTTATTGGAAAACTTCCCCAT
GATCGCTCGGCAGATGCAGGCTGGCCTCGAAAGGCTGTTTCTTGAATTCTCCGCCGTCTTTGAGAAGCCCTTACC
TCCTCCTCCCTCCGCCTCTGACATACCCGATCCGCAGCCAATGGGCCCTATTGAGGCCGCGGCCAAGAGGGCCCG
CTCTGAAAGTCTCGGACTGAGGAACGGCGACAGGGCTCCCGCCAAGCTGCCCGTTATGGAGAACTTTTACGCCGA
AGACGACGAAGACGTCATGAGGGCCGCGCTCGAGACCGCTGTCACAACCGCTATCGACCTCTTCCAGGGCGTCGA
CAAGCAACAGCTGTCTCTCCTCGGCGCCACGACCGACCTGACTGGCCCGCTCGTCGAGAAGCTCATTGAACGCTA
CGTCTCCGACAATGTTCATCATCTGCTCTTTCCCAAGCTCGCCGTCCTCAAGCGACCCGACGATCTGCTGCTCGA
AGCCAGGATAAGAAAAATGGAGTTCATTGACGTGTCGCAACTGGGCATTGCCATCGACGGCGGCCCGAGGGCTAA
ACTTGATCTGCTCATCCAGTTAGGGCCCGTTGCTGACGAGTTCAAGAAGATCTCAGCCGCCCGAAGCCCTGGGGA
CATGATGGACACCCTGTTGGCAACCACTAAGGCTGTCTCCCGCTTGGCTCCAGCATCCGGTGTGGCGAGTGGTGG
CCGAGAGTCGGCGGCGTCAGAAAAGCCCATGCTTACTGCCAATGCCGATACGCTCGTTTCCCTCCTACTCTTTGT
CGTCATCCGTTCCCAGATTCGCAATTTGCAGGCACGAATCGCCTACGTGCGCAATTTCATCTTTGTTGACGACAT
CGAGAGTGGAGAGATGGGTTACGCCTTGAGCACCTTTGAGGCTGTGCTGGCATACTTGCTTCTGGACTCGACAGG
CTTATACAAGGCCAGCAGGAGGAACAAGGCCTTGTGGGAGGCGACAAAGAAGGCTGATCTGGCAGAACTGAGAAA
CATTATGGAGCTGAGCACGTCGGCCATTGATAATTGCGGGGGAGATTACAACGATCTGTTCGGCGAAGGCGAGGA
AAACGGAGCAATCGAGGGTGATGGATCGCGAAGTCCCCTGAAGCCCTGCCGGCGCCCCTCGTTGACGGCTTGGAA
CCTCGTCAATGGCTTGTCCGTAACGCCATTGCTGGGTACCATCGTCTCGGACCGGTTTTCACACGGCTCAGACCT
CAGCCACGTCTTCCCCTTTCAGGCGAATGGCGACGACCTGCCGATTCCTGTTAAGAGGATCAAGAGGGTGGCCAT
GGACACCAGAAGCATGTCGAGCGGGTCCGAAATATCGTTCCAGTCCCGCACGACGAGCCTAGGAACCAATAGTAG
CGCCATTGAGGGCGACATATCGGTGGCAAAGCTGGCCCAGACAACCGACGCTTTGGGCCAGTCGGTGCTGATGAT
GGCGGTACAGCACAGGCAGACAGCCGCCTTGGCGTATCTGCTGAGTCTTTCGGGCTACTACCCGATCGACGTAGT
TCTGCAGGACATGGATGTCGAGCGCACGACGCTCTTGAGCGCCGCGACGCAACTGGGTCACGCAGAGCTGATCGA
CATGGTCCTGAATTACATCGTGTCCCAAGCTTCGGTGCCGCAGCTCTCGCGGTACCTATCGGAACAGGACGTCCG
GGGCCGCAGTGTGGGCCACTATCTTTTCCACGCGCCCTGGCTCATCCGACGGATCGGCCACATGATAGCGTGGCG
GCAGCGGGACAAGAACGGGCAGACGCCGCTGTTTGCCCTGTGCCGGTCCTACGATCATGCGGATTACCACAGTAT
GGTCGAGGCCGGGCTGGCGGCGGCGCGAGAATCGCAGGGCGACGGGCAGGCGCTGCACGTGGACGACCATGTTGA
CGGCAAGGGAAACACGCTTCTGCACATCATTAACGATGCGAGGCTTGCGACGCGGATCCTGCAGCACGGCGACGT
CGACGTCAACGCGACCAACGAAAGGCGCTTCACGGCGCTCATGGTGGCCAGCAAGTACGGGCGGTACGACATGGT
GCGGTGCCTCTTCGCCGATTCGCGCGTCGACGTGGCGGCGCGGGAGTTACGCGGGCTGACGGCGGTCGAGCTGGC
CAAGGATGACGAAGTGCGCAACAAGATCGACGACCTGGGCCTGTTCAGAACGCCGGCCGGACGCGACGGGCGTAT
TACGGGCGTGGTGCGGGCCTTTTTCGTTGAGGACGGAAGCGTGCGGCTAGTGCTCAAGTCGGCGGCGCCGACGGA
CCGCGACAGCTACACGGTGACGACGAGCCGGCGATCGCTGGCGGAGCTGGAGCGTATGGCGCAGCTGCTGGCGCT
CGAGCACCCGGCCTCGTGGATCCCGACGCTGGCCGAGATGCGGTCCCCCTTTCAACTGCCGACGAAGCCGTCGCG
GGCCCTGCTACGCGACATACAGCTCCATGCCGACTGGTTTCTGCGCATCATGCTGGGACACCCGACGCTAGCGAC
GCACGAGATGCTGTGGGAGTTTTTCCTGGTGCCTGAGCTGCAGCTTGACGCCATGGAGCAGCGGACGCGGCTCAA
GCTGGAGACAAGACGCGACAAGATCAAGGACGAGTACGAGCCTGTGGAAGACGTGGGCGAGGTGGAGCGATTTGC
TAGCCACGCGAGAGACATGGTCAGAAGCGTCGGCTTCTCGACCAAGGGGGTTGCCAGGAGGGTGAATGCCGTGGG
ACTGTCGGCCTCAGGTGAGCCACTCATACATGGTCTCAGTGAGCCATTCGACTGACACAAGTTCCTAGATTTGTA
CGACTCAATGGTGTTGCTGCACAGACAGGTGTCGGCGGTGCACTTCATGCCACGCTCGCATGTGGACGCGTTCGA
GTTCTACGTCAGGGCCGTGGCGCCGGCGCAGTCGAGCGCACAAGCGGGGCTGCATACGACGTTGCTGGCGATGCA
GTCGACGGTGCAGGCACTGTTGTCGTCCCTGTCGCGGCCTGGGCTGCTGATCGAGCGATACTGGGCGGCGTGGAG
CGAGGCGAACCGTCAGGCGAGTTCGGGGGCGCGGTCGTCCCGGTGGCCGCTCGGGATCCTTGATGAGACGCGACA
GAGGCTCCTAGATGGGCGGGAGCAGCGAGTGCGGCGGCTGCGGGACGAGGCCGAGGAGGCGGCGCGCGAGCTGCG
GTACACGCAGCAGACGGTGGCTGCCGAGCTGGCCGGGTGGCAGGAGATGCACGAGAGCATGGGCAGGCGGGCGAT
GCGCGAGTACGCGCGGGCCATGGTGGTGCAGGAGCGGATGAGGCTCAGCGGGATGATGCGTGCCCTGAGGAGGGT
GAGGCGCGACAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail