Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04701
Gene name
Locationscaffold_05:249882..250816
Strand-
Gene length (bp)934
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00089 Trypsin Trypsin 8.6E-52 27 260
PF13365 Trypsin_2 Trypsin-like peptidase domain 2.6E-09 57 232

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0004175 endopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1391 0.061 0.9406 0.0833 0.0733 0.0286 0.2133 0.1469 0.1028 0.005

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999697

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup8205
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04701 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6413

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04701
MAVNTLLHLALLAMSPVSMAATLSKRIIGGGEAQSGEFPYLVGIMNRQKEVEVSCGGLLLDSKTVLTAAHCATND
TRVLGPQNLRIRAGSLHLQSGGIESNVSQIVMHPGYNHSTLDSDIAILKLVDPIQEDLPKISYNTRLADEGSDPA
PNETVVLAGWGVTSDGSKPQWLKKVEMPVVSREICRESYAKSPSRLPITKNKICAGKHGSTGCEGDSGGPLISKS
SGQVVGIVSHGSGPDCNAPGTFGAYTRVANYLSFIRENMECGKTC*
Coding >Ophcf2|04701
ATGGCTGTCAACACGCTCCTTCACTTGGCTCTGCTAGCCATGTCCCCAGTCTCTATGGCGGCCACGCTCTCAAAG
CGAATAATCGGCGGCGGCGAAGCCCAGTCGGGCGAGTTCCCTTACCTTGTCGGCATCATGAACCGGCAGAAGGAG
GTAGAGGTCAGCTGCGGAGGCCTGCTGCTCGACTCGAAAACGGTCTTGACGGCGGCTCATTGCGCCACCAACGAC
ACGAGAGTACTGGGCCCGCAAAATCTGCGTATCCGAGCGGGAAGCCTTCATCTCCAGTCCGGTGGTATCGAGTCC
AACGTGTCCCAAATCGTCATGCACCCGGGCTACAACCATTCCACGCTTGATAGCGACATTGCCATTCTTAAGCTG
GTCGATCCCATTCAAGAGGACTTGCCAAAAATCAGCTACAACACCCGTCTGGCAGACGAGGGCTCAGACCCTGCT
CCCAATGAGACTGTCGTCCTAGCAGGATGGGGCGTAACTTCTGACGGGTCGAAGCCTCAGTGGTTGAAGAAGGTC
GAGATGCCTGTCGTTTCGCGAGAGATTTGCCGAGAATCCTACGCCAAGTCACCGTCGCGCCTGCCCATCACCAAG
AATAAGATATGCGCTGGAAAGCACGGCTCGACGGGTTGCGAAGGAGACAGCGGCGGTCCGCTCATCAGCAAGTCG
TCGGGACAAGTGGTTGGCATTGTATCGCACGGGTCAGGACCCGACTGCAATGCTCCGGGAACGTTTGGCGCTTAT
ACAAGGGTGGCTAATTATCTGTCCTTTATCCGGGAGAATATGGAGTGTGGTAAGACTTGTTAA
Transcript >Ophcf2|04701
ATGGCTGTCAACACGCTCCTTCACTTGGCTCTGCTAGCCATGTCCCCAGTCTCTATGGCGGCCACGCTCTCAAAG
CGAATAATCGGCGGCGGCGAAGCCCAGTCGGGCGAGTTCCCTTACCTTGTCGGCATCATGAACCGGCAGAAGGAG
GTAGAGGTCAGCTGCGGAGGCCTGCTGCTCGACTCGAAAACGGTCTTGACGGCGGCTCATTGCGCCACCAACGAC
ACGAGAGTACTGGGCCCGCAAAATCTGCGTATCCGAGCGGGAAGCCTTCATCTCCAGTCCGGTGGTATCGAGTCC
AACGTGTCCCAAATCGTCATGCACCCGGGCTACAACCATTCCACGCTTGATAGCGACATTGCCATTCTTAAGCTG
GTCGATCCCATTCAAGAGGACTTGCCAAAAATCAGCTACAACACCCGTCTGGCAGACGAGGGCTCAGACCCTGCT
CCCAATGAGACTGTCGTCCTAGCAGGATGGGGCGTAACTTCTGACGGGTCGAAGCCTCAGTGGTTGAAGAAGGTC
GAGATGCCTGTCGTTTCGCGAGAGATTTGCCGAGAATCCTACGCCAAGTCACCGTCGCGCCTGCCCATCACCAAG
AATAAGATATGCGCTGGAAAGCACGGCTCGACGGGTTGCGAAGGAGACAGCGGCGGTCCGCTCATCAGCAAGTCG
TCGGGACAAGTGGTTGGCATTGTATCGCACGGGTCAGGACCCGACTGCAATGCTCCGGGAACGTTTGGCGCTTAT
ACAAGGGTGGCTAATTATCTGTCCTTTATCCGGGAGAATATGGAGTGTGGTAAGACTTGTTAA
Gene >Ophcf2|04701
ATGGCTGTCAACACGCTCCTTCACTTGGCTCTGCTAGCCATGTCCCCAGTCTCTATGGCGGCCACGCTCTCAAAG
CGAATAATCGGCGGCGGCGAAGCCCAGTCGGGCGAGTTCCCTTACCTTGTCGGCATCATGAACCGGCAGAAGGAG
GTAGAGGTCAGCTGCGGAGGCCTGCTGCTCGACTCGAAAACGGTCTTGACGGCGGCTCATTGCGCCACCAACGAC
ACGAGAGTACTGGGCCCGCAAAATCTGCGTATCCGAGCGGGAAGCCTTGTAGGTTTTGGTGCCAGGACAGAGAAC
ATATGAAATGGGAGAAGTTGACGCCGGATTGCGCAGCATCTCCAGTCCGGTGGTATCGAGTCCAACGTGTCCCAA
ATCGTCATGCACCCGGGCTACAACCATTCCACGCTTGATAGCGACATTGCCATTCTTAAGCTGGTCGATCCCATT
CAAGAGGACTTGCCAAAAATCAGCTACAACACCCGTCTGGCAGACGAGGGCTCAGACCCTGCTCCCAATGAGACT
GTCGTCCTAGCAGGATGGTTAGTGGACATGCCGCGCCTGGGAAATGCCGACTAACGTGTCCATTCTATATTCCAG
GGGCGTAACTTCTGACGGGTCGAAGCCTCAGTGGTTGAAGAAGGTCGAGATGCCTGTCGTTTCGCGAGAGATTTG
CCGAGAATCCTACGCCAAGTCACCGTCGCGCCTGCCCATCACCAAGAATAAGATATGCGCTGGAAAGCACGGCTC
GACGGGTTGCGAAGGAGACAGCGGCGGTCCGCTCATCAGCAAGTCGTCGGGACAAGTGGTTGGCATTGTATCGCA
CGGGTCAGGACCCGACTGCAATGCTCCGGGAACGTTTGGCGCTTATACAAGGGTGGCTAATTATCTGTCCTTTAT
CCGGGAGAATATGGAGTGTGGTAAGACTTGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail