Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04694
Gene name
Locationscaffold_05:232252..235132
Strand+
Gene length (bp)2880
Transcript length (bp)2814
Coding sequence length (bp)2814
Protein length (aa) 938

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.1E-27 807 929
PF04389 Peptidase_M28 Peptidase family M28 3.9E-14 546 719
PF02225 PA PA domain 8.1E-08 354 444

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 208 230 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04694
MAPEKQPFYHPSPPSYDQALAGSSRGASNVAYDDDDDIESLSARYASSQRLSHDEHVPSSPIAESQQLLSVSQPR
ASSSAVLIRNNGYRPPTVETDDEESLAGGFGGHREDDDSDDDDDDDAATVRREIEQMDLDEPPSTRGSSWPKMLP
GFSLPSWTWPWPRLPELSRLRQRMAAAFENNQNQDEDAPRRRWPFNLDEEDKRRLCQVCIRFIVALVVLTFVVLY
VTTTMDVRYRRFDPQDLRQHVMTNVEPMRLRASVMHFSNYAHIAGTEGDYATAMDVETMFSRAGLDRIEVDEYRV
YVNYPRKDGRAVQIMNEAGSEPVWTAKLDEDEVGGETTGRQTYAFHGLSKSGDVRGPLLYANYGTRDDFAHLRDR
GIETRGAIALVRHRRNSVAPSDAGMQVKAAELAGFAGCLIYTDPADDGFLKGDVAPHGRWMPTDAVRRDSVGLRG
WMPGDVLTPGWESESKVPRMKVNETTGLVGIPSLPLAWRDAKELLRQLNGHGERVPAGWAGGVPDLSGGWWTGNQ
TSPVVRLRNEQDEQLQQPIWNVYGKIVGQEQAERAVLVGNHRDSWAFGAGDPHAGTAVMIELARILGGLLARGWR
PLRTIEFMSWDGASYNLMGSTEFVEKRTDELREAAYAYVNLDGAVSGTKLRAAGSPALQRPLERAMHHVLDSRAN
ATLAELWRSKGGRLRGLGAGGDYAALQHTAGTSSLDLAFVVDDDDSKGVPVAHSSYDRLALIEDVVDPGFAYHVL
LAQLVGVLLLDLADRPVVSFGMKAYADALKEAVSDLDGWIKVRIGDDKKTEREQAVRELVDAAALVGQNAQIFDG
WELEWDRQMLETGGRETLELSARRFLYNDRKAAFETALLDLELGGGIPNRTQFKHVVYGPQLWAPSRADIFPAIR
DTVEADDWPAARRAVAKAAAVLRKAASVLTMDDGREA*
Coding >Ophcf2|04694
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCAAATGTCGCGTACGACGACGACGACGACATTGAGTCGCTTTCAGCACGATACGCCTCGTCGCAACGC
CTCAGCCACGATGAGCATGTTCCCTCGTCACCGATAGCCGAGTCACAGCAACTCCTCTCCGTCAGCCAGCCTCGT
GCCTCGTCGTCGGCTGTCTTGATCCGTAACAACGGATACCGACCTCCGACGGTGGAGACAGACGATGAAGAGAGT
CTGGCGGGCGGCTTCGGAGGCCATCGAGAAGATGATGACTCCGACGACGACGATGACGATGATGCAGCCACGGTG
CGGCGCGAGATAGAGCAGATGGACCTGGATGAGCCGCCGTCAACACGAGGCTCCTCCTGGCCCAAGATGCTTCCG
GGCTTCTCCTTGCCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCG
GCTGCTTTCGAAAATAACCAAAATCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTTGATGAGGAA
GATAAGAGGCGATTGTGTCAAGTCTGCATCCGCTTCATCGTCGCCCTCGTCGTCTTGACTTTCGTCGTCCTCTAC
GTCACCACCACCATGGACGTGCGCTACCGCCGATTCGATCCTCAAGACCTCCGCCAACACGTCATGACCAACGTC
GAGCCCATGCGTCTACGCGCTTCGGTCATGCACTTTTCTAATTATGCCCATATCGCCGGCACTGAGGGCGACTAC
GCGACTGCCATGGACGTTGAGACCATGTTCAGTCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTA
TACGTCAACTATCCGCGCAAGGACGGACGCGCTGTTCAAATCATGAATGAGGCCGGCTCGGAGCCAGTCTGGACC
GCCAAGCTGGACGAGGACGAGGTAGGTGGCGAGACGACCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAG
TCGGGCGACGTCAGGGGCCCCCTCTTGTACGCAAACTACGGCACGCGCGACGACTTCGCTCATCTCCGCGACCGG
GGGATCGAAACGCGAGGCGCCATTGCGCTGGTGCGCCACCGCCGCAACTCCGTCGCGCCGTCGGACGCGGGGATG
CAGGTCAAAGCGGCCGAGCTGGCTGGCTTCGCGGGCTGCCTTATATACACGGACCCGGCCGATGACGGCTTCCTC
AAGGGCGACGTGGCGCCCCACGGCCGCTGGATGCCTACCGACGCCGTGCGCCGCGACTCGGTCGGTCTCAGGGGC
TGGATGCCGGGCGACGTGTTGACACCCGGGTGGGAGAGCGAGAGCAAGGTGCCGCGGATGAAGGTCAATGAGACG
ACGGGTCTGGTGGGCATTCCGAGCCTGCCGCTGGCCTGGCGCGACGCGAAGGAACTTCTGCGCCAGCTCAACGGC
CACGGTGAGCGCGTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGCTGGTGGACTGGCAACCAG
ACGTCGCCTGTAGTACGACTGCGGAACGAGCAAGACGAGCAGCTGCAGCAGCCCATCTGGAACGTGTACGGCAAA
ATTGTCGGCCAGGAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGAGACTCTTGGGCGTTTGGCGCCGGC
GACCCGCACGCCGGGACGGCCGTCATGATCGAGCTGGCACGCATCTTGGGCGGACTGCTCGCCCGCGGCTGGCGG
CCGTTGCGGACCATCGAGTTCATGTCGTGGGACGGCGCTTCCTACAACCTAATGGGATCGACCGAGTTTGTCGAG
AAGCGAACGGATGAGCTGCGCGAGGCCGCCTACGCCTACGTCAACCTCGACGGCGCCGTGTCCGGCACGAAGCTA
CGGGCCGCGGGCTCGCCGGCTCTGCAGCGGCCGCTGGAACGGGCAATGCACCACGTACTGGACTCGCGGGCCAAC
GCAACGCTGGCCGAGCTGTGGCGCTCCAAAGGCGGCCGTCTCCGCGGACTCGGCGCCGGGGGAGACTACGCTGCG
CTGCAGCACACGGCCGGCACGAGCTCGCTCGACCTGGCCTTTGTTGTTGACGATGACGACTCCAAGGGCGTTCCC
GTCGCGCACTCGAGCTATGACAGGCTGGCGCTGATCGAAGACGTGGTCGACCCGGGCTTCGCCTACCACGTGCTA
CTGGCCCAGTTGGTGGGCGTGCTGCTGCTAGACTTGGCGGATCGGCCGGTGGTGTCGTTTGGGATGAAGGCGTAC
GCCGACGCGCTGAAGGAGGCCGTCTCCGATCTCGACGGCTGGATCAAGGTCCGGATTGGCGACGACAAGAAGACG
GAACGGGAACAGGCGGTCCGCGAGCTCGTCGACGCTGCTGCGCTGGTGGGACAGAACGCTCAGATCTTTGACGGC
TGGGAGCTCGAATGGGACCGGCAGATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGGCGCTTC
CTGTACAATGACCGGAAGGCGGCTTTCGAGACGGCGCTGCTGGACTTGGAGTTGGGCGGAGGCATCCCCAACCGC
ACGCAGTTCAAGCACGTCGTCTACGGGCCCCAGCTTTGGGCGCCATCCCGCGCGGACATCTTCCCAGCCATTCGC
GACACGGTAGAGGCCGACGACTGGCCCGCGGCGAGGCGGGCTGTTGCCAAGGCAGCGGCCGTCTTGAGAAAGGCG
GCTTCGGTTCTGACGATGGATGATGGGCGGGAAGCCTGA
Transcript >Ophcf2|04694
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCAAATGTCGCGTACGACGACGACGACGACATTGAGTCGCTTTCAGCACGATACGCCTCGTCGCAACGC
CTCAGCCACGATGAGCATGTTCCCTCGTCACCGATAGCCGAGTCACAGCAACTCCTCTCCGTCAGCCAGCCTCGT
GCCTCGTCGTCGGCTGTCTTGATCCGTAACAACGGATACCGACCTCCGACGGTGGAGACAGACGATGAAGAGAGT
CTGGCGGGCGGCTTCGGAGGCCATCGAGAAGATGATGACTCCGACGACGACGATGACGATGATGCAGCCACGGTG
CGGCGCGAGATAGAGCAGATGGACCTGGATGAGCCGCCGTCAACACGAGGCTCCTCCTGGCCCAAGATGCTTCCG
GGCTTCTCCTTGCCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCG
GCTGCTTTCGAAAATAACCAAAATCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTTGATGAGGAA
GATAAGAGGCGATTGTGTCAAGTCTGCATCCGCTTCATCGTCGCCCTCGTCGTCTTGACTTTCGTCGTCCTCTAC
GTCACCACCACCATGGACGTGCGCTACCGCCGATTCGATCCTCAAGACCTCCGCCAACACGTCATGACCAACGTC
GAGCCCATGCGTCTACGCGCTTCGGTCATGCACTTTTCTAATTATGCCCATATCGCCGGCACTGAGGGCGACTAC
GCGACTGCCATGGACGTTGAGACCATGTTCAGTCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTA
TACGTCAACTATCCGCGCAAGGACGGACGCGCTGTTCAAATCATGAATGAGGCCGGCTCGGAGCCAGTCTGGACC
GCCAAGCTGGACGAGGACGAGGTAGGTGGCGAGACGACCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAG
TCGGGCGACGTCAGGGGCCCCCTCTTGTACGCAAACTACGGCACGCGCGACGACTTCGCTCATCTCCGCGACCGG
GGGATCGAAACGCGAGGCGCCATTGCGCTGGTGCGCCACCGCCGCAACTCCGTCGCGCCGTCGGACGCGGGGATG
CAGGTCAAAGCGGCCGAGCTGGCTGGCTTCGCGGGCTGCCTTATATACACGGACCCGGCCGATGACGGCTTCCTC
AAGGGCGACGTGGCGCCCCACGGCCGCTGGATGCCTACCGACGCCGTGCGCCGCGACTCGGTCGGTCTCAGGGGC
TGGATGCCGGGCGACGTGTTGACACCCGGGTGGGAGAGCGAGAGCAAGGTGCCGCGGATGAAGGTCAATGAGACG
ACGGGTCTGGTGGGCATTCCGAGCCTGCCGCTGGCCTGGCGCGACGCGAAGGAACTTCTGCGCCAGCTCAACGGC
CACGGTGAGCGCGTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGCTGGTGGACTGGCAACCAG
ACGTCGCCTGTAGTACGACTGCGGAACGAGCAAGACGAGCAGCTGCAGCAGCCCATCTGGAACGTGTACGGCAAA
ATTGTCGGCCAGGAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGAGACTCTTGGGCGTTTGGCGCCGGC
GACCCGCACGCCGGGACGGCCGTCATGATCGAGCTGGCACGCATCTTGGGCGGACTGCTCGCCCGCGGCTGGCGG
CCGTTGCGGACCATCGAGTTCATGTCGTGGGACGGCGCTTCCTACAACCTAATGGGATCGACCGAGTTTGTCGAG
AAGCGAACGGATGAGCTGCGCGAGGCCGCCTACGCCTACGTCAACCTCGACGGCGCCGTGTCCGGCACGAAGCTA
CGGGCCGCGGGCTCGCCGGCTCTGCAGCGGCCGCTGGAACGGGCAATGCACCACGTACTGGACTCGCGGGCCAAC
GCAACGCTGGCCGAGCTGTGGCGCTCCAAAGGCGGCCGTCTCCGCGGACTCGGCGCCGGGGGAGACTACGCTGCG
CTGCAGCACACGGCCGGCACGAGCTCGCTCGACCTGGCCTTTGTTGTTGACGATGACGACTCCAAGGGCGTTCCC
GTCGCGCACTCGAGCTATGACAGGCTGGCGCTGATCGAAGACGTGGTCGACCCGGGCTTCGCCTACCACGTGCTA
CTGGCCCAGTTGGTGGGCGTGCTGCTGCTAGACTTGGCGGATCGGCCGGTGGTGTCGTTTGGGATGAAGGCGTAC
GCCGACGCGCTGAAGGAGGCCGTCTCCGATCTCGACGGCTGGATCAAGGTCCGGATTGGCGACGACAAGAAGACG
GAACGGGAACAGGCGGTCCGCGAGCTCGTCGACGCTGCTGCGCTGGTGGGACAGAACGCTCAGATCTTTGACGGC
TGGGAGCTCGAATGGGACCGGCAGATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGGCGCTTC
CTGTACAATGACCGGAAGGCGGCTTTCGAGACGGCGCTGCTGGACTTGGAGTTGGGCGGAGGCATCCCCAACCGC
ACGCAGTTCAAGCACGTCGTCTACGGGCCCCAGCTTTGGGCGCCATCCCGCGCGGACATCTTCCCAGCCATTCGC
GACACGGTAGAGGCCGACGACTGGCCCGCGGCGAGGCGGGCTGTTGCCAAGGCAGCGGCCGTCTTGAGAAAGGCG
GCTTCGGTTCTGACGATGGATGATGGGCGGGAAGCCTGA
Gene >Ophcf2|04694
ATGGCTCCGGAGAAGCAGCCCTTCTACCACCCGTCGCCGCCCTCGTACGACCAGGCTCTGGCGGGCAGCAGCCGT
GGTGCCTCAAATGTCGCGTACGACGACGACGACGACATTGAGTCGCTTTCAGCACGATACGCCTCGTCGCAACGC
CTCAGCCACGATGAGCATGTTCCCTCGTCACCGATAGCCGAGTCACAGCAACTCCTCTCCGTCAGCCAGCCTCGT
GCCTCGTCGTCGGCTGTCTTGATCCGTAACAACGGATACCGACCTCCGACGGTGGAGACAGACGATGAAGAGAGT
CTGGCGGGCGGCTTCGGAGGCCATCGAGAAGATGATGACTCCGACGACGACGATGACGATGATGCAGCCACGGTG
CGGCGCGAGATAGAGCAGATGGACCTGGATGAGCCGCCGTCAACACGAGGCTCCTCCTGGCCCAAGATGCTTCCG
GGCTTCTCCTTGCCGAGCTGGACCTGGCCCTGGCCGAGGCTACCCGAGCTGAGCCGCCTCCGTCAAAGGATGGCG
GCTGCTTTCGAAAATAACCAAAATCAAGATGAAGACGCGCCTCGACGCCGCTGGCCCTTTAATCTTGATGAGGAA
GATAAGAGGCGATTGTGTCAAGTCTGCATCCGCTTCATCGTCGCCCTCGTCGTCTTGACTTTCGTCGTCCTCTAC
GTCACCACCACCATGGACGTGCGCTACCGCCGATTCGATCCTCAAGACCTCCGCCAACACGTCATGACCAACGTC
GAGCCCATGCGTCTACGCGCTTCGGTCATGCACTTTTCTAATTATGCCCATATCGCCGGCACTGAGGGCGACTAC
GCGACTGCCATGGACGTTGAGACCATGTTCAGTCGGGCTGGGCTCGACCGCATCGAAGTCGACGAGTACCGCGTA
TACGTCAACTATCCGCGCAAGGACGGACGCGCTGTTCAAATCATGAATGAGGCCGGCTCGGAGCCAGTCTGGACC
GCCAAGCTGGACGAGGACGAGGTAGGTGGCGAGACGACCGGACGGCAGACGTACGCCTTCCACGGCCTGTCCAAG
TCGGGCGACGTCAGGGGCCCCCTCTTGTACGCAAACTACGGCACGCGCGACGACTTCGCTCATCTCCGCGACCGG
GGGATCGAAACGCGAGGCGCCATTGCGCTGGTGCGCCACCGCCGCAACTCCGTCGCGCCGTCGGACGCGGGGATG
CAGGTCAAAGCGGCCGAGCTGGCTGGCTTCGCGGGCTGCCTTATATACACGGACCCGGCCGATGACGGCTTCCTC
AAGGGCGACGTGGCGCCCCACGGCCGCTGGATGCCTACCGACGCCGTGCGCCGCGACTCGGTCGGTCTCAGGGGC
TGGATGCCGGGCGACGTGTTGACACCCGGGTGGGAGAGCGAGAGCAAGGTGCCGCGGATGAAGGTCAATGAGACG
ACGGGTCTGGTGGGCATTCCGAGCCTGCCGCTGGCCTGGCGCGACGCGAAGGAACTTCTGCGCCAGCTCAACGGC
CACGGTGAGCGCGTGCCGGCTGGCTGGGCGGGCGGCGTGCCGGACCTGAGCGGCGGCTGGTGGACTGGCAACCAG
ACGTCGCCTGTAGTACGACTGCGGAACGAGCAAGACGAGCAGCTGCAGCAGCCCATCTGGAACGTGTACGGCAAA
ATTGTCGGCCAGGAGCAGGCAGAGCGGGCAGTCTTGGTGGGCAACCATCGAGACTCTTGGGCGTTTGGCGCCGGC
GACCCGCACGCCGGGACGGCCGTCATGATCGAGCTGGCACGCATCTTGGGCGGACTGCTCGCCCGCGGCTGGCGG
CCGTTGCGGACCATCGAGTTCATGTCGTGGGACGGCGCTTCCTACAACCTAATGGGATCGACCGAGTTTGTCGAG
AAGCGAACGGATGAGCTGCGCGAGGCCGCCTACGCCTACGTCAACCTCGACGGCGCCGTGTCCGGCACGAAGCTA
CGGGCCGCGGGCTCGCCGGCTCTGCAGCGGCCGCTGGAACGGGCAATGCACCACGTACTGGACTCGCGGGCCAAC
GCAACGCTGGCCGAGCTGTGGCGCTCCAAAGGCGGCCGTCTCCGCGGACTCGGCGCCGGGGGAGACTACGCTGCG
CTGCAGCACACGGCCGGCACGAGCTCGCTCGACCTGGCCTTTGTTGTTGACGATGACGACTCCAAGGGCGTTCCC
GTCGCGCACTCGAGCTATGACAGGCTGGCGCTGATCGAAGACGTGGTCGACCCGGGCTTCGCCTACCACGTGCTA
CTGGCCCAGTTGGTGGGCGTGCTGCTGCTAGACTTGGCGGATCGGCCGGTGGTGTCGTTTGGGATGAAGGCGTAC
GCCGACGCGCTGAAGGAGGCCGTCTCCGATCTCGACGGCTGGATCAAGGTCCGGATTGGCGACGACAAGAAGACG
GAACGGGAACAGGCGGTCCGCGAGCTCGTCGACGCTGCTGCGCTGGTGGGACAGAACGCTCAGATCTTTGACGGC
TGGGAGCTCGAATGGGACCGGCAGATGCTGGAGACGGGCGGACGCGAGACTCTCGAACTGTCGGCGCGGCGCTTC
CTGTACAATGACCGGAAGGCGGCTTTCGAGACGGCGCTGCTGGACTTGGAGTTGGGCGGAGGCGTGAGTTTTTCC
TGTTTTTCTTCTCCATCGTCTGTTGTGTCACACGGAGCTCATATCCCTTTTTAGATCCCCAACCGCACGCAGTTC
AAGCACGTCGTCTACGGGCCCCAGCTTTGGGCGCCATCCCGCGCGGACATCTTCCCAGCCATTCGCGACACGGTA
GAGGCCGACGACTGGCCCGCGGCGAGGCGGGCTGTTGCCAAGGCAGCGGCCGTCTTGAGAAAGGCGGCTTCGGTT
CTGACGATGGATGATGGGCGGGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail