Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04693
Gene name
Locationscaffold_05:228518..231408
Strand+
Gene length (bp)2890
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03635 Vps35 Vacuolar protein sorting-associated protein 35 5.1E-297 13 854

GO

GO Term Description Terminal node
GO:0042147 retrograde transport, endosome to Golgi Yes
GO:0030906 retromer, cargo-selective complex Yes
GO:0015031 protein transport Yes
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0032991 protein-containing complex No
GO:0016197 endosomal transport No
GO:0016482 cytosolic transport No
GO:0005575 cellular_component No
GO:0016192 vesicle-mediated transport No
GO:0071705 nitrogen compound transport No
GO:0098796 membrane protein complex No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4488 0.7424 0.0439 0.1295 0.0195 0.0017 0.1261 0.3825 0.3282 0.0113

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4187
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5158
Ophiocordyceps australis map64 (Brazil) OphauB2|8089
Ophiocordyceps camponoti-floridani Ophcf2|04693 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6421
Ophiocordyceps kimflemingae Ophio5|6729
Ophiocordyceps subramaniannii Hirsu2|8504

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04693
MTTPAPPEDQARLLEDALAAVRQQTSLMRKCLDTPGKLMDALKCCSTLVSELRTSSLGPKQYYELYMAVFDALRY
LSVHLRENHPVNHLADLYELVQYAGNIVPRMYLMITVGTAYMSIADAPVKELMKDMMDMSRGVQHPIRGLFLRYY
LSGQARDYLPTTDSEGPDGNLADSISFILTNFVEMNKLWVRLQHQGHSREREHRIRERKELQLLVGSNIVRLSQL
VDLETYKSTILAPLLEQVVQCRDVLAQEYLLEVITQVFPDEFHLHTLDQFLGAVSRLNPHVDVKAIVIGLMDRLS
EYADREGSSKDKGAVQQAKVEAEALANLLQRVTLPQDGPQIPASALAQDDSSAAAVNGGEGGSEQQPEQQQQAAK
GDDADAGDQTINGRTADAGSSSVPLYDIFFMQVKNLVEAQHLPIQDIMALLVSLCNLALNNYPDRLDYVDQILAY
ATTKTKENANNADLHSPAAQQSLLALLQAPLTRYVSMFTALSLPMYVPLFQCQSYPTRRAVAGGVARTLLRDQVR
ISRPQQLVSILDIMSVLIREGSPPTGSQPYPHHHHRRGAETDETVEEQGWLARMLHLLQADDNDTQLELVRMARK
ALAEGNDRVRTTTTPALMTACLKLARRFKAREHYDDGCDAQCTALFKLVHSALSDLYARVNGSAELALRLFCMAG
QTADMTGFEEAAYELYAQAFTVYEEAVTDSKSQFQAVCVIASSLHQTRNFGKENYDTLITKCAQHGSKLLRKPDQ
CRAVYLASHLWWATSSSPTTAAAATTTTSSSDAAEQQQNLYRDGKRVLECLQRALRVADSCMETATSIELFVEIL
DRYVYYFDQQNESVTTKYLNGLIELIHSNLAGNQQESPSIESSKKHFHQTLENIRSRQYEGVVLYPS*
Coding >Ophcf2|04693
ATGACGACGCCTGCGCCCCCTGAGGATCAGGCTCGTCTGCTCGAGGATGCGCTCGCGGCGGTGCGCCAGCAGACG
TCGCTCATGCGCAAGTGCCTCGACACGCCCGGAAAGCTCATGGATGCCCTAAAGTGCTGCTCGACGCTCGTGTCG
GAGCTCCGAACCAGTAGCCTCGGCCCTAAGCAGTATTACGAGCTCTACATGGCCGTCTTTGACGCTCTCCGCTAC
CTATCGGTGCATCTGCGAGAAAACCACCCAGTCAACCACCTGGCGGATCTGTACGAGCTGGTTCAGTACGCGGGC
AACATCGTTCCGCGCATGTATCTCATGATCACCGTTGGCACCGCATACATGTCCATCGCCGACGCGCCCGTCAAG
GAGCTTATGAAGGACATGATGGACATGAGTCGCGGCGTCCAGCATCCCATCCGCGGCCTCTTTCTCCGCTACTAT
CTCTCAGGACAGGCCCGCGACTACCTACCGACGACGGACAGCGAAGGGCCTGACGGGAATCTAGCCGACTCGATC
AGTTTTATCCTCACAAACTTTGTCGAGATGAACAAGTTGTGGGTGCGTTTGCAGCACCAGGGTCACTCGCGGGAG
CGCGAACATCGTATCCGCGAGCGAAAGGAGCTGCAGCTGCTCGTCGGCAGCAATATTGTCCGCCTGAGCCAGCTG
GTCGACCTCGAGACGTACAAGTCGACCATCCTGGCCCCGCTACTGGAACAGGTGGTCCAGTGTCGAGACGTGCTG
GCGCAGGAGTATCTGCTGGAGGTCATTACCCAGGTCTTCCCGGACGAGTTCCACCTGCACACGCTAGATCAGTTC
CTCGGCGCCGTGTCGCGTCTGAACCCGCATGTCGACGTCAAGGCCATTGTCATCGGCCTCATGGACCGTCTATCC
GAGTACGCCGACCGTGAGGGCTCAAGCAAAGACAAAGGAGCCGTCCAGCAGGCCAAGGTCGAGGCCGAAGCACTG
GCCAACCTGCTACAGCGCGTCACGCTCCCCCAGGACGGGCCACAAATACCGGCTTCGGCCCTCGCGCAAGACGAC
TCCAGTGCCGCCGCTGTCAATGGCGGCGAGGGCGGGTCGGAGCAGCAGCCGGAGCAGCAGCAGCAAGCGGCCAAG
GGCGATGATGCCGACGCCGGCGACCAGACCATCAATGGACGGACGGCCGACGCCGGCAGCAGCAGCGTGCCGCTC
TACGACATCTTCTTCATGCAGGTCAAGAACTTGGTCGAGGCCCAGCACCTCCCGATTCAGGACATCATGGCGCTT
CTTGTGTCACTCTGCAACCTGGCGCTCAACAACTACCCGGACCGGCTCGACTACGTGGACCAGATTCTGGCCTAC
GCAACGACCAAGACCAAGGAGAACGCCAACAATGCCGACCTGCACTCGCCGGCGGCGCAGCAGAGCCTGCTGGCG
CTGCTTCAGGCGCCGCTGACGCGATACGTCTCCATGTTCACGGCGCTGTCGCTACCGATGTACGTGCCCCTGTTT
CAGTGCCAGTCGTATCCGACGCGACGGGCAGTGGCCGGTGGCGTGGCGCGAACGCTGCTGCGGGATCAGGTCAGG
ATCTCGCGGCCGCAGCAGCTGGTCAGCATCCTCGACATCATGTCGGTTCTCATCAGAGAGGGTTCCCCCCCAACG
GGCTCCCAGCCGTATCCTCACCACCACCACCGAAGAGGGGCTGAGACGGATGAGACGGTTGAGGAGCAGGGTTGG
CTGGCGCGGATGTTGCACCTGTTGCAGGCCGACGACAATGACACGCAGCTGGAACTGGTGCGGATGGCGCGCAAG
GCTTTGGCCGAGGGCAACGATCGGGTCCGGACGACGACGACGCCGGCCCTCATGACGGCCTGCCTCAAGCTAGCC
CGTCGCTTCAAAGCGCGCGAGCACTACGATGACGGCTGCGACGCCCAGTGCACCGCCCTCTTCAAGCTCGTCCAC
TCGGCTCTCAGCGATCTGTACGCGCGCGTCAACGGCTCGGCCGAGCTGGCGCTGCGCCTCTTCTGCATGGCCGGC
CAGACGGCCGACATGACGGGCTTCGAGGAGGCCGCCTACGAGCTGTACGCCCAGGCCTTTACCGTATACGAGGAG
GCCGTGACGGACTCCAAGTCTCAGTTCCAGGCCGTCTGCGTCATCGCCTCCTCGCTGCACCAGACGCGCAACTTT
GGCAAGGAGAATTACGACACGCTCATCACAAAGTGCGCTCAGCACGGGAGCAAGTTGCTTCGCAAGCCTGACCAG
TGCCGAGCCGTCTACCTGGCCAGCCATCTGTGGTGGGCGACTTCTTCCTCTCCTACCACGGCAGCTGCTGCAACC
ACGACGACGTCGTCATCAGACGCAGCAGAGCAACAGCAGAACCTCTATCGCGACGGGAAGCGCGTCCTCGAGTGT
CTGCAGCGGGCTCTGCGCGTGGCCGATTCATGCATGGAGACGGCCACGTCGATTGAGCTGTTTGTCGAGATTCTC
GACCGCTACGTCTACTACTTTGACCAGCAGAATGAATCTGTAACGACAAAATATCTCAACGGCCTCATCGAGCTC
ATCCACTCCAACCTCGCCGGCAATCAGCAAGAGTCGCCTTCCATCGAGTCGAGCAAGAAGCATTTCCACCAGACG
CTGGAGAATATTCGCAGCAGGCAGTACGAGGGCGTCGTTCTGTATCCGAGCTAG
Transcript >Ophcf2|04693
ATGACGACGCCTGCGCCCCCTGAGGATCAGGCTCGTCTGCTCGAGGATGCGCTCGCGGCGGTGCGCCAGCAGACG
TCGCTCATGCGCAAGTGCCTCGACACGCCCGGAAAGCTCATGGATGCCCTAAAGTGCTGCTCGACGCTCGTGTCG
GAGCTCCGAACCAGTAGCCTCGGCCCTAAGCAGTATTACGAGCTCTACATGGCCGTCTTTGACGCTCTCCGCTAC
CTATCGGTGCATCTGCGAGAAAACCACCCAGTCAACCACCTGGCGGATCTGTACGAGCTGGTTCAGTACGCGGGC
AACATCGTTCCGCGCATGTATCTCATGATCACCGTTGGCACCGCATACATGTCCATCGCCGACGCGCCCGTCAAG
GAGCTTATGAAGGACATGATGGACATGAGTCGCGGCGTCCAGCATCCCATCCGCGGCCTCTTTCTCCGCTACTAT
CTCTCAGGACAGGCCCGCGACTACCTACCGACGACGGACAGCGAAGGGCCTGACGGGAATCTAGCCGACTCGATC
AGTTTTATCCTCACAAACTTTGTCGAGATGAACAAGTTGTGGGTGCGTTTGCAGCACCAGGGTCACTCGCGGGAG
CGCGAACATCGTATCCGCGAGCGAAAGGAGCTGCAGCTGCTCGTCGGCAGCAATATTGTCCGCCTGAGCCAGCTG
GTCGACCTCGAGACGTACAAGTCGACCATCCTGGCCCCGCTACTGGAACAGGTGGTCCAGTGTCGAGACGTGCTG
GCGCAGGAGTATCTGCTGGAGGTCATTACCCAGGTCTTCCCGGACGAGTTCCACCTGCACACGCTAGATCAGTTC
CTCGGCGCCGTGTCGCGTCTGAACCCGCATGTCGACGTCAAGGCCATTGTCATCGGCCTCATGGACCGTCTATCC
GAGTACGCCGACCGTGAGGGCTCAAGCAAAGACAAAGGAGCCGTCCAGCAGGCCAAGGTCGAGGCCGAAGCACTG
GCCAACCTGCTACAGCGCGTCACGCTCCCCCAGGACGGGCCACAAATACCGGCTTCGGCCCTCGCGCAAGACGAC
TCCAGTGCCGCCGCTGTCAATGGCGGCGAGGGCGGGTCGGAGCAGCAGCCGGAGCAGCAGCAGCAAGCGGCCAAG
GGCGATGATGCCGACGCCGGCGACCAGACCATCAATGGACGGACGGCCGACGCCGGCAGCAGCAGCGTGCCGCTC
TACGACATCTTCTTCATGCAGGTCAAGAACTTGGTCGAGGCCCAGCACCTCCCGATTCAGGACATCATGGCGCTT
CTTGTGTCACTCTGCAACCTGGCGCTCAACAACTACCCGGACCGGCTCGACTACGTGGACCAGATTCTGGCCTAC
GCAACGACCAAGACCAAGGAGAACGCCAACAATGCCGACCTGCACTCGCCGGCGGCGCAGCAGAGCCTGCTGGCG
CTGCTTCAGGCGCCGCTGACGCGATACGTCTCCATGTTCACGGCGCTGTCGCTACCGATGTACGTGCCCCTGTTT
CAGTGCCAGTCGTATCCGACGCGACGGGCAGTGGCCGGTGGCGTGGCGCGAACGCTGCTGCGGGATCAGGTCAGG
ATCTCGCGGCCGCAGCAGCTGGTCAGCATCCTCGACATCATGTCGGTTCTCATCAGAGAGGGTTCCCCCCCAACG
GGCTCCCAGCCGTATCCTCACCACCACCACCGAAGAGGGGCTGAGACGGATGAGACGGTTGAGGAGCAGGGTTGG
CTGGCGCGGATGTTGCACCTGTTGCAGGCCGACGACAATGACACGCAGCTGGAACTGGTGCGGATGGCGCGCAAG
GCTTTGGCCGAGGGCAACGATCGGGTCCGGACGACGACGACGCCGGCCCTCATGACGGCCTGCCTCAAGCTAGCC
CGTCGCTTCAAAGCGCGCGAGCACTACGATGACGGCTGCGACGCCCAGTGCACCGCCCTCTTCAAGCTCGTCCAC
TCGGCTCTCAGCGATCTGTACGCGCGCGTCAACGGCTCGGCCGAGCTGGCGCTGCGCCTCTTCTGCATGGCCGGC
CAGACGGCCGACATGACGGGCTTCGAGGAGGCCGCCTACGAGCTGTACGCCCAGGCCTTTACCGTATACGAGGAG
GCCGTGACGGACTCCAAGTCTCAGTTCCAGGCCGTCTGCGTCATCGCCTCCTCGCTGCACCAGACGCGCAACTTT
GGCAAGGAGAATTACGACACGCTCATCACAAAGTGCGCTCAGCACGGGAGCAAGTTGCTTCGCAAGCCTGACCAG
TGCCGAGCCGTCTACCTGGCCAGCCATCTGTGGTGGGCGACTTCTTCCTCTCCTACCACGGCAGCTGCTGCAACC
ACGACGACGTCGTCATCAGACGCAGCAGAGCAACAGCAGAACCTCTATCGCGACGGGAAGCGCGTCCTCGAGTGT
CTGCAGCGGGCTCTGCGCGTGGCCGATTCATGCATGGAGACGGCCACGTCGATTGAGCTGTTTGTCGAGATTCTC
GACCGCTACGTCTACTACTTTGACCAGCAGAATGAATCTGTAACGACAAAATATCTCAACGGCCTCATCGAGCTC
ATCCACTCCAACCTCGCCGGCAATCAGCAAGAGTCGCCTTCCATCGAGTCGAGCAAGAAGCATTTCCACCAGACG
CTGGAGAATATTCGCAGCAGGCAGTACGAGGGCGTCGTTCTGTATCCGAGCTAG
Gene >Ophcf2|04693
ATGACGACGCCTGCGCCCCCTGAGGATCAGGCTCGTCTGCTCGAGGATGCGCTCGCGGCGGTGCGCCAGCAGACG
TCGCTCATGCGCAAGTGCCTCGACACGCCCGGAAAGCTCATGGATGCCCTAAAGTGCTGGTTCGTCTGACTCCCA
CCCCTCCCCCATGGGGGCCCTCTCTCGTCTCCCACTCCTCTAAAGGCCATCATCCCAAAGCTCGACGCTCGTGTC
GGAGCTCCGAACCAGTAGCCTCGGCCCTAAGCAGTATTACGAGCTCTACATGGCCGTCTTTGACGCTCTCCGCTA
CCTATCGGTGCATCTGCGAGAAAACCACCCAGTCAACCACCTGGCGGATCTGTACGAGCTGGTTCAGTACGCGGG
CAACATCGTTCCGCGCATGTATCTCATGATCACCGTTGGCACCGCATACATGTCCATCGCCGACGCGCCCGTCAA
GGAGCTTATGAAGGACATGATGGACATGAGTCGCGGCGTCCAGCATCCCATCCGCGGCCTCTTTCTCCGCTACTA
TCTCTCAGGACAGGCCCGCGACTACCTACCGACGACGGACAGCGAAGGGCCTGACGGGAATCTAGCCGACTCGAT
CAGTTTTATCCTCACAAACTTTGTCGAGATGAACAAGTTGTGGGTGCGTTTGCAGCACCAGGGTCACTCGCGGGA
GCGCGAACATCGTATCCGCGAGCGAAAGGAGCTGCAGCTGCTCGTCGGCAGCAATATTGTCCGCCTGAGCCAGCT
GGTCGACCTCGAGACGTACAAGTCGACCATCCTGGCCCCGCTACTGGAACAGGTGGTCCAGTGTCGAGACGTGCT
GGCGCAGGAGTATCTGCTGGAGGTCATTACCCAGGTCTTCCCGGACGAGTTCCACCTGCACACGCTAGATCAGTT
CCTCGGCGCCGTGTCGCGTCTGAACCCGCATGTCGACGTCAAGGCCATTGTCATCGGCCTCATGGACCGTCTATC
CGAGTACGCCGACCGTGAGGGCTCAAGCAAAGACAAAGGAGCCGTCCAGCAGGCCAAGGTCGAGGCCGAAGCACT
GGCCAACCTGCTACAGCGCGTCACGCTCCCCCAGGACGGGCCACAAATACCGGCTTCGGCCCTCGCGCAAGACGA
CTCCAGTGCCGCCGCTGTCAATGGCGGCGAGGGCGGGTCGGAGCAGCAGCCGGAGCAGCAGCAGCAAGCGGCCAA
GGGCGATGATGCCGACGCCGGCGACCAGACCATCAATGGACGGACGGCCGACGCCGGCAGCAGCAGCGTGCCGCT
CTACGACATCTTCTTCATGCAGGTCAAGAACTTGGTCGAGGCCCAGCACCTCCCGATTCAGGACATCATGGCGCT
TCTTGTGTCACTCTGCAACCTGGCGCTCAACAACTACCCGGACCGGCTCGACTACGTGGACCAGATTCTGGCCTA
CGCAACGACCAAGACCAAGGAGAACGCCAACAATGCCGACCTGCACTCGCCGGCGGCGCAGCAGAGCCTGCTGGC
GCTGCTTCAGGCGCCGCTGACGCGATACGTCTCCATGTTCACGGCGCTGTCGCTACCGATGTACGTGCCCCTGTT
TCAGTGCCAGTCGTATCCGACGCGACGGGCAGTGGCCGGTGGCGTGGCGCGAACGCTGCTGCGGGATCAGGTCAG
GATCTCGCGGCCGCAGCAGCTGGTCAGCATCCTCGACATCATGTCGGTTCTCATCAGAGAGGGTTCCCCCCCAAC
GGGCTCCCAGCCGTATCCTCACCACCACCACCGAAGAGGGGCTGAGACGGATGAGACGGTTGAGGAGCAGGGTTG
GCTGGCGCGGATGTTGCACCTGTTGCAGGCCGACGACAATGACACGCAGCTGGAACTGGTGCGGATGGCGCGCAA
GGCTTTGGCCGAGGGCAACGATCGGGTCCGGACGACGACGACGCCGGCCCTCATGACGGCCTGCCTCAAGCTAGC
CCGTCGCTTCAAAGCGCGCGAGCACTACGATGACGGCTGCGACGCCCAGTGCACCGCCCTCTTCAAGCTCGTCCA
CTCGGCTCTCAGCGATCTGTACGCGCGCGTCAACGGCTCGGCCGAGCTGGCGCTGCGCCTCTTCTGCATGGCCGG
CCAGACGGCCGACATGACGGGCTTCGAGGAGGCCGCCTACGAGCTGTACGCCCAGGCCTTTACCGTATACGAGGA
GGCCGTGACGGACTCCAAGTCTCAGTTCCAGGCCGTCTGCGTCATCGCCTCCTCGCTGCACCAGACGCGCAACTT
TGGCAAGGAGAATTACGACACGCTCATCACAAAGTGCGCTCAGCACGGGAGCAAGTTGCTTCGCAAGCCTGACCA
GTGCCGAGCCGTCTACCTGGCCAGCCATCTGTGGTGGGCGACTTCTTCCTCTCCTACCACGGCAGCTGCTGCAAC
CACGACGACGTCGTCATCAGACGCAGCAGAGGTAAGAATCAAATGCTTGCACTTGATCGTATGGCAGAAGGCATC
TGGACTTGCTCATGACTGATCCGCTCTGCAACAAGCAGCAACAGCAGAACCTCTATCGCGACGGGAAGCGCGTCC
TCGAGTGTCTGCAGCGGGCTCTGCGCGTGGCCGATTCATGCATGGAGACGGCCACGTCGATTGAGCTGTTTGTCG
AGATTCTCGACCGCTACGTCTACTACTTTGACCAGCAGAATGAATCTGTGCGTACGCAGTAGATATCCGTATCAT
CGCATCCTCTAACGTGGCGAAACAGGTAACGACAAAATATCTCAACGGCCTCATCGAGCTCATCCACTCCAACCT
CGCCGGCAATCAGCAAGAGTCGCCTTCCATCGAGTCGAGCAAGAAGCATTTCCACCAGACGCTGGAGAATATTCG
CAGCAGGCAGTACGAGGGCGTCGTTCTGTATCCGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail