Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04689
Gene name
Locationscaffold_05:217486..218648
Strand+
Gene length (bp)1162
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16546 SGTA_dimer Homodimerisation domain of SGTA 1.1E-23 8 71
PF00515 TPR_1 Tetratricopeptide repeat 2.4E-08 110 143
PF07719 TPR_2 Tetratricopeptide repeat 6.2E-07 110 143
PF13414 TPR_11 TPR repeat 8.8E-09 117 154
PF13181 TPR_8 Tetratricopeptide repeat 1.1E-02 116 143
PF13181 TPR_8 Tetratricopeptide repeat 1.8E-01 179 206
PF13432 TPR_16 Tetratricopeptide repeat 2.7E-04 116 163
PF13432 TPR_16 Tetratricopeptide repeat 1.0E-02 156 203

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.7362 0.5849 0.1197 0.0218 0.2816 0.0239 0.3641 0.0709 0.2961 0.3352

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5406
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6140
Ophiocordyceps australis map64 (Brazil) OphauB2|3808
Ophiocordyceps camponoti-floridani Ophcf2|04689 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6426
Ophiocordyceps kimflemingae Ophio5|5322
Ophiocordyceps subramaniannii Hirsu2|5646

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04689
MASQQSSRQRLALAICHFLNTSLSDGTLAADEKDSIDVAVSCIADSFKVDAADEQAVKSAVGTKSLLQIFSVYDN
LKSNEGTSTSASASSSASASKPSSEKPSESQKKEAEGLKSKGNAAMAQKQYQQAITLYSQALDLDPTNAVFLSNR
AAAHSAAKDHSSAKQDAEAAVAIDPSYTKAWSRLGLARFALGDAKGAMEAYAKGIEHEGNGGSEAMRKGFETAKR
RVDELDGAADAGDNISSSRTAPQSSPSGMPDFGSIMSNPMFASMAQNLMSNPDLMSSLMSNPRLREMADSFGAGG
AGGGGMPDIGSLMSDPNIADMARNLMGGANPGQDRNNNNNNSQP*
Coding >Ophcf2|04689
ATGGCATCGCAGCAAAGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTTCTCAACACGTCGCTCTCGGAC
GGGACTCTCGCCGCCGATGAAAAGGACTCCATCGACGTGGCCGTCAGTTGCATCGCGGATTCCTTCAAGGTCGAC
GCCGCAGATGAGCAGGCGGTAAAGTCGGCGGTGGGAACGAAGTCGCTATTGCAAATCTTCTCAGTCTACGATAAT
CTCAAAAGCAACGAAGGCACAAGCACAAGCGCCAGTGCCAGTTCCAGCGCCAGCGCCAGCAAGCCAAGCTCCGAG
AAGCCATCGGAATCGCAGAAGAAGGAGGCCGAAGGCCTCAAATCCAAGGGGAACGCCGCCATGGCCCAGAAACAA
TACCAACAAGCCATAACCCTCTACAGCCAAGCCCTCGACCTCGACCCCACAAACGCAGTCTTCCTCTCCAACCGC
GCGGCCGCTCACTCGGCCGCAAAGGATCACTCTAGCGCAAAACAGGACGCCGAAGCCGCCGTCGCCATCGACCCT
TCCTACACAAAGGCCTGGTCTCGCCTCGGACTCGCCCGCTTCGCTCTCGGGGACGCAAAGGGCGCCATGGAAGCT
TACGCAAAGGGCATCGAGCATGAGGGCAACGGCGGGTCGGAAGCGATGCGCAAGGGCTTCGAGACGGCCAAGCGT
CGCGTCGACGAATTGGACGGCGCCGCAGATGCCGGCGACAACATCTCTTCATCCCGCACCGCGCCCCAGTCTTCC
CCTTCGGGCATGCCCGACTTCGGCTCCATCATGAGCAACCCAATGTTCGCCAGCATGGCCCAGAACCTCATGAGC
AACCCGGACCTCATGTCAAGCCTCATGAGCAACCCGCGCCTTCGCGAGATGGCCGACTCGTTTGGCGCCGGAGGT
GCCGGAGGTGGCGGAATGCCCGATATCGGCAGCCTCATGTCCGACCCTAATATCGCCGACATGGCACGCAATCTC
ATGGGCGGCGCGAATCCCGGCCAGGACAGAAACAACAACAATAATAACTCGCAGCCTTAA
Transcript >Ophcf2|04689
ATGGCATCGCAGCAAAGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTTCTCAACACGTCGCTCTCGGAC
GGGACTCTCGCCGCCGATGAAAAGGACTCCATCGACGTGGCCGTCAGTTGCATCGCGGATTCCTTCAAGGTCGAC
GCCGCAGATGAGCAGGCGGTAAAGTCGGCGGTGGGAACGAAGTCGCTATTGCAAATCTTCTCAGTCTACGATAAT
CTCAAAAGCAACGAAGGCACAAGCACAAGCGCCAGTGCCAGTTCCAGCGCCAGCGCCAGCAAGCCAAGCTCCGAG
AAGCCATCGGAATCGCAGAAGAAGGAGGCCGAAGGCCTCAAATCCAAGGGGAACGCCGCCATGGCCCAGAAACAA
TACCAACAAGCCATAACCCTCTACAGCCAAGCCCTCGACCTCGACCCCACAAACGCAGTCTTCCTCTCCAACCGC
GCGGCCGCTCACTCGGCCGCAAAGGATCACTCTAGCGCAAAACAGGACGCCGAAGCCGCCGTCGCCATCGACCCT
TCCTACACAAAGGCCTGGTCTCGCCTCGGACTCGCCCGCTTCGCTCTCGGGGACGCAAAGGGCGCCATGGAAGCT
TACGCAAAGGGCATCGAGCATGAGGGCAACGGCGGGTCGGAAGCGATGCGCAAGGGCTTCGAGACGGCCAAGCGT
CGCGTCGACGAATTGGACGGCGCCGCAGATGCCGGCGACAACATCTCTTCATCCCGCACCGCGCCCCAGTCTTCC
CCTTCGGGCATGCCCGACTTCGGCTCCATCATGAGCAACCCAATGTTCGCCAGCATGGCCCAGAACCTCATGAGC
AACCCGGACCTCATGTCAAGCCTCATGAGCAACCCGCGCCTTCGCGAGATGGCCGACTCGTTTGGCGCCGGAGGT
GCCGGAGGTGGCGGAATGCCCGATATCGGCAGCCTCATGTCCGACCCTAATATCGCCGACATGGCACGCAATCTC
ATGGGCGGCGCGAATCCCGGCCAGGACAGAAACAACAACAATAATAACTCGCAGCCTTAA
Gene >Ophcf2|04689
ATGGTTCTTTCCCCTTCCCCCCTCTATCTCCTCCCCTTTCTTCCCCACCGACAAGCTGACCGCGAACCTCACCCC
CAGGCATCGCAGCAAAGCTCGAGGCAGCGCCTCGCCCTCGCCATCTGTCACTTTCTCAACACGTCGCTCTCGGAC
GGGACTCTCGCCGCCGATGAAAAGGACTCCATCGACGTGGCCGTCAGTTGCATCGCGGATTCCTTCAAGGTCGAC
GCCGCAGATGAGCAGGCGGTAAAGTCGGCGGTGGGAACGAAGTCGCTATTGCAAATCTTCTCAGTCTACGATAAT
CTCAAAAGCAACGAAGGCACAAGCACAAGCGCCAGTGCCAGTTCCAGCGCCAGCGCCAGCAAGCCAAGCTCCGAG
AAGCCATCGGAATCGCAGAAGAAGGAGGCCGAAGGCCTCAAATCCAAGGGGAACGCCGCCATGGCCCAGAAACAA
TACCAACAAGCCATAACCCTCTACAGCCAAGCCCTCGACCTCGACCCCACAAACGCAGTCTTCCTCTCCAACCGC
GCGGCCGCTCACTCGGCCGCAAAGGATCACTCTAGCGCAAAACAGGACGCCGAAGCCGCCGTCGCCATCGACCCT
TCCTACACAAAGGCCTGGTCTCGCCTCGGACTCGCCCGCTTCGCTCTCGGGGACGCAAAGGGCGCCATGGAAGCT
TACGCAAAGGGCATCGAGCATGAGGGCAACGGCGGGTCGGAAGCGATGCGCAAGGGCTTCGAGACGGCCAAGCGT
CGCGTCGACGAATTGGACGGCGCCGCAGATGCCGGCGACAACATCTCTTCATCCCGCACCGCGCCCCAGTCTTCC
CCTTCGGGCATGCCCGACTTCGGCTCCATCATGAGCAACCCAATGTTCGCCAGCATGGCCCAGAACCTCATGAGC
AACCCGGACCTCATGTCAAGCCTCATGAGCAACCCGCGCCTTCGCGAGATGGCCGACTCGTTTGGCGCCGGAGGT
GCCGGAGGTGGCGGAATGCCCGATATCGGCAGCCTCATGTCCGACCCTAATATCGCCGACATGTCAGTCTTTCTC
GACCACTGTCGTCTCTCTGAACTTGCTAACTTGACTTAGGGCACGCAATCTCATGGGCGGCGCGAATCCCGGCCA
GGACAGAAACAACAACAATAATAACTCGCAGCCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail